BLASTX nr result
ID: Rehmannia31_contig00009993
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00009993 (254 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN19144.1| 26S proteasome regulatory complex, subunit RPN3/P... 54 3e-06 ref|XP_012855383.1| PREDICTED: probable 26S proteasome non-ATPas... 53 5e-06 ref|XP_011092961.1| probable 26S proteasome non-ATPase regulator... 52 7e-06 ref|XP_012837194.1| PREDICTED: probable 26S proteasome non-ATPas... 52 7e-06 >gb|PIN19144.1| 26S proteasome regulatory complex, subunit RPN3/PSMD3 [Handroanthus impetiginosus] Length = 488 Score = 53.5 bits (127), Expect = 3e-06 Identities = 29/49 (59%), Positives = 30/49 (61%) Frame = -1 Query: 149 LIEMGAYTREVRRIVRAIRWTIQXXXXXXXXXXXXXXXXXXLPGSEVHS 3 LIE GAYTREVRRIVRA+RWTIQ LPGSEVHS Sbjct: 35 LIETGAYTREVRRIVRAVRWTIQLRKKLKAPLISAFLSFALLPGSEVHS 83 >ref|XP_012855383.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 3 [Erythranthe guttata] gb|EYU22574.1| hypothetical protein MIMGU_mgv1a005362mg [Erythranthe guttata] Length = 487 Score = 52.8 bits (125), Expect = 5e-06 Identities = 28/49 (57%), Positives = 30/49 (61%) Frame = -1 Query: 149 LIEMGAYTREVRRIVRAIRWTIQXXXXXXXXXXXXXXXXXXLPGSEVHS 3 LIE GAYTREVRRIVRAIRWTIQ +PGS+VHS Sbjct: 37 LIETGAYTREVRRIVRAIRWTIQLRKNLKASVLSAFLNFALVPGSDVHS 85 >ref|XP_011092961.1| probable 26S proteasome non-ATPase regulatory subunit 3 [Sesamum indicum] ref|XP_011092962.1| probable 26S proteasome non-ATPase regulatory subunit 3 [Sesamum indicum] Length = 488 Score = 52.4 bits (124), Expect = 7e-06 Identities = 28/48 (58%), Positives = 29/48 (60%) Frame = -1 Query: 146 IEMGAYTREVRRIVRAIRWTIQXXXXXXXXXXXXXXXXXXLPGSEVHS 3 IE GAYTREVRRIVRAIRWTIQ +PGSEVHS Sbjct: 36 IETGAYTREVRRIVRAIRWTIQLRKKLNASVLSAFLNFSLVPGSEVHS 83 >ref|XP_012837194.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 3 [Erythranthe guttata] ref|XP_012837196.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 3 [Erythranthe guttata] gb|EYU37968.1| hypothetical protein MIMGU_mgv1a005284mg [Erythranthe guttata] gb|EYU37969.1| hypothetical protein MIMGU_mgv1a005284mg [Erythranthe guttata] Length = 490 Score = 52.4 bits (124), Expect = 7e-06 Identities = 28/49 (57%), Positives = 30/49 (61%) Frame = -1 Query: 149 LIEMGAYTREVRRIVRAIRWTIQXXXXXXXXXXXXXXXXXXLPGSEVHS 3 LIE GAY+REVRRIVRAIRWTIQ +PGSEVHS Sbjct: 37 LIETGAYSREVRRIVRAIRWTIQLRKNLNASVLSAFLSFALVPGSEVHS 85