BLASTX nr result
ID: Rehmannia31_contig00009890
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00009890 (429 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011085779.1| mitochondrial outer membrane protein porin o... 72 3e-12 ref|XP_011085778.1| mitochondrial outer membrane protein porin o... 72 3e-12 gb|EPS57816.1| hypothetical protein M569_17001 [Genlisea aurea] 72 3e-12 ref|XP_020552089.1| mitochondrial outer membrane protein porin o... 72 3e-12 gb|PIM99988.1| Porin/voltage-dependent anion-selective channel p... 70 2e-11 ref|XP_022883332.1| mitochondrial outer membrane protein porin o... 68 4e-11 ref|XP_022999729.1| mitochondrial outer membrane protein porin o... 69 5e-11 gb|PIN16338.1| Porin/voltage-dependent anion-selective channel p... 69 6e-11 ref|XP_012840637.1| PREDICTED: mitochondrial outer membrane prot... 69 6e-11 gb|OMP06764.1| hypothetical protein COLO4_07927 [Corchorus olito... 69 8e-11 ref|XP_023528139.1| mitochondrial outer membrane protein porin o... 68 1e-10 ref|XP_022934414.1| mitochondrial outer membrane protein porin o... 68 1e-10 ref|XP_022928719.1| mitochondrial outer membrane protein porin o... 68 1e-10 ref|XP_022844857.1| mitochondrial outer membrane protein porin o... 68 1e-10 ref|XP_013450932.1| porin/voltage-dependent anion-selective chan... 67 1e-10 ref|XP_022894997.1| mitochondrial outer membrane protein porin o... 66 2e-10 ref|XP_022152186.1| mitochondrial outer membrane protein porin o... 67 2e-10 ref|XP_008443436.1| PREDICTED: mitochondrial outer membrane prot... 67 2e-10 ref|XP_011652245.1| PREDICTED: mitochondrial outer membrane prot... 67 2e-10 gb|PNY05681.1| mitochondrial outer membrane protein porin [Trifo... 67 3e-10 >ref|XP_011085779.1| mitochondrial outer membrane protein porin of 34 kDa [Sesamum indicum] Length = 276 Score = 72.0 bits (175), Expect = 3e-12 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +2 Query: 329 MGKGPGLYSDIGKRARDLLYKDYNSDQKFTLTT 427 MGKGPGLYSDIGKRARDLLYKDYNSDQKFTLTT Sbjct: 1 MGKGPGLYSDIGKRARDLLYKDYNSDQKFTLTT 33 >ref|XP_011085778.1| mitochondrial outer membrane protein porin of 34 kDa isoform X2 [Sesamum indicum] Length = 276 Score = 72.0 bits (175), Expect = 3e-12 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +2 Query: 329 MGKGPGLYSDIGKRARDLLYKDYNSDQKFTLTT 427 MGKGPGLYSDIGKRARDLLYKDYNSDQKFTLTT Sbjct: 1 MGKGPGLYSDIGKRARDLLYKDYNSDQKFTLTT 33 >gb|EPS57816.1| hypothetical protein M569_17001 [Genlisea aurea] Length = 276 Score = 72.0 bits (175), Expect = 3e-12 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +2 Query: 329 MGKGPGLYSDIGKRARDLLYKDYNSDQKFTLTT 427 MGKGPGLYSDIGKRARDLLYKDYNSDQKFTLTT Sbjct: 1 MGKGPGLYSDIGKRARDLLYKDYNSDQKFTLTT 33 >ref|XP_020552089.1| mitochondrial outer membrane protein porin of 34 kDa isoform X1 [Sesamum indicum] Length = 285 Score = 72.0 bits (175), Expect = 3e-12 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = +2 Query: 329 MGKGPGLYSDIGKRARDLLYKDYNSDQKFTLTT 427 MGKGPGLYSDIGKRARDLLYKDYNSDQKFTLTT Sbjct: 1 MGKGPGLYSDIGKRARDLLYKDYNSDQKFTLTT 33 >gb|PIM99988.1| Porin/voltage-dependent anion-selective channel protein [Handroanthus impetiginosus] Length = 276 Score = 69.7 bits (169), Expect = 2e-11 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = +2 Query: 329 MGKGPGLYSDIGKRARDLLYKDYNSDQKFTLTT 427 MGKGPGLY+DIGKRARDLLYKDYNSDQKFT+TT Sbjct: 1 MGKGPGLYTDIGKRARDLLYKDYNSDQKFTVTT 33 >ref|XP_022883332.1| mitochondrial outer membrane protein porin of 34 kDa-like [Olea europaea var. sylvestris] Length = 192 Score = 67.8 bits (164), Expect = 4e-11 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +2 Query: 329 MGKGPGLYSDIGKRARDLLYKDYNSDQKFTLTT 427 MGKGPGLYSDIGKRARDLLY+DY SDQKFT+TT Sbjct: 1 MGKGPGLYSDIGKRARDLLYRDYQSDQKFTITT 33 >ref|XP_022999729.1| mitochondrial outer membrane protein porin of 36 kDa-like [Cucurbita maxima] Length = 358 Score = 69.3 bits (168), Expect = 5e-11 Identities = 37/58 (63%), Positives = 42/58 (72%), Gaps = 4/58 (6%) Frame = +2 Query: 266 HFSL----SIFSVNFRFFQF*VKKIMGKGPGLYSDIGKRARDLLYKDYNSDQKFTLTT 427 HFSL +F++ F +K MGKGPGLYSDIGKRARDLLYKDY SD KFT+TT Sbjct: 64 HFSLCAQPKLFNLVFS------EKAMGKGPGLYSDIGKRARDLLYKDYQSDHKFTVTT 115 >gb|PIN16338.1| Porin/voltage-dependent anion-selective channel protein [Handroanthus impetiginosus] Length = 276 Score = 68.6 bits (166), Expect = 6e-11 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = +2 Query: 329 MGKGPGLYSDIGKRARDLLYKDYNSDQKFTLTT 427 MGKGPGLY+DIGKRARDLLYKDY SDQKFTLTT Sbjct: 1 MGKGPGLYTDIGKRARDLLYKDYQSDQKFTLTT 33 >ref|XP_012840637.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa-like [Erythranthe guttata] gb|EYU34669.1| hypothetical protein MIMGU_mgv1a011608mg [Erythranthe guttata] Length = 276 Score = 68.6 bits (166), Expect = 6e-11 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = +2 Query: 329 MGKGPGLYSDIGKRARDLLYKDYNSDQKFTLTT 427 MGKGPGLYSDIGKRARDLL KDYNSDQKFTLTT Sbjct: 1 MGKGPGLYSDIGKRARDLLNKDYNSDQKFTLTT 33 >gb|OMP06764.1| hypothetical protein COLO4_07927 [Corchorus olitorius] Length = 337 Score = 68.6 bits (166), Expect = 8e-11 Identities = 34/49 (69%), Positives = 39/49 (79%) Frame = +2 Query: 281 IFSVNFRFFQF*VKKIMGKGPGLYSDIGKRARDLLYKDYNSDQKFTLTT 427 + S++FR F KK MGKGPGLY+DIGK+ARDLLYKDY D KFTLTT Sbjct: 47 LLSLSFRSI-FSGKKSMGKGPGLYTDIGKKARDLLYKDYQGDHKFTLTT 94 >ref|XP_023528139.1| mitochondrial outer membrane protein porin of 34 kDa [Cucurbita pepo subsp. pepo] ref|XP_023528140.1| mitochondrial outer membrane protein porin of 34 kDa [Cucurbita pepo subsp. pepo] Length = 276 Score = 67.8 bits (164), Expect = 1e-10 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +2 Query: 329 MGKGPGLYSDIGKRARDLLYKDYNSDQKFTLTT 427 MGKGPGLYSDIGKRARDLLY+DY SDQKFT+TT Sbjct: 1 MGKGPGLYSDIGKRARDLLYRDYQSDQKFTITT 33 >ref|XP_022934414.1| mitochondrial outer membrane protein porin of 34 kDa [Cucurbita moschata] ref|XP_022983848.1| mitochondrial outer membrane protein porin of 34 kDa [Cucurbita maxima] Length = 276 Score = 67.8 bits (164), Expect = 1e-10 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +2 Query: 329 MGKGPGLYSDIGKRARDLLYKDYNSDQKFTLTT 427 MGKGPGLYSDIGKRARDLLY+DY SDQKFT+TT Sbjct: 1 MGKGPGLYSDIGKRARDLLYRDYQSDQKFTITT 33 >ref|XP_022928719.1| mitochondrial outer membrane protein porin of 34 kDa-like [Cucurbita moschata] ref|XP_022971329.1| mitochondrial outer membrane protein porin of 34 kDa-like [Cucurbita maxima] ref|XP_023531639.1| mitochondrial outer membrane protein porin of 34 kDa-like [Cucurbita pepo subsp. pepo] Length = 276 Score = 67.8 bits (164), Expect = 1e-10 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +2 Query: 329 MGKGPGLYSDIGKRARDLLYKDYNSDQKFTLTT 427 MGKGPGLYSDIGKRARDLLY+DY SDQKFT+TT Sbjct: 1 MGKGPGLYSDIGKRARDLLYRDYQSDQKFTITT 33 >ref|XP_022844857.1| mitochondrial outer membrane protein porin of 34 kDa [Olea europaea var. sylvestris] Length = 276 Score = 67.8 bits (164), Expect = 1e-10 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +2 Query: 329 MGKGPGLYSDIGKRARDLLYKDYNSDQKFTLTT 427 MGKGPGLYSDIGKRARDLLY+DY SDQKFT+TT Sbjct: 1 MGKGPGLYSDIGKRARDLLYRDYQSDQKFTITT 33 >ref|XP_013450932.1| porin/voltage-dependent anion-selective channel protein [Medicago truncatula] gb|AFK34190.1| unknown [Medicago truncatula] gb|KEH24972.1| porin/voltage-dependent anion-selective channel protein [Medicago truncatula] Length = 278 Score = 67.4 bits (163), Expect = 1e-10 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +2 Query: 329 MGKGPGLYSDIGKRARDLLYKDYNSDQKFTLTT 427 M KGPGLYSDIGK+ARDLLYKDYN+DQKFTLTT Sbjct: 1 MSKGPGLYSDIGKKARDLLYKDYNTDQKFTLTT 33 >ref|XP_022894997.1| mitochondrial outer membrane protein porin of 34 kDa-like, partial [Olea europaea var. sylvestris] Length = 192 Score = 65.9 bits (159), Expect = 2e-10 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +2 Query: 329 MGKGPGLYSDIGKRARDLLYKDYNSDQKFTLTT 427 MGKGPGLYSDIGKRARDLLY+DY DQKFT+TT Sbjct: 1 MGKGPGLYSDIGKRARDLLYRDYQCDQKFTITT 33 >ref|XP_022152186.1| mitochondrial outer membrane protein porin of 34 kDa [Momordica charantia] Length = 276 Score = 67.0 bits (162), Expect = 2e-10 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +2 Query: 329 MGKGPGLYSDIGKRARDLLYKDYNSDQKFTLTT 427 MGKGPGLYSDIGKRARDLLYKDY SD KFT+TT Sbjct: 1 MGKGPGLYSDIGKRARDLLYKDYQSDHKFTITT 33 >ref|XP_008443436.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa [Cucumis melo] Length = 276 Score = 67.0 bits (162), Expect = 2e-10 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +2 Query: 329 MGKGPGLYSDIGKRARDLLYKDYNSDQKFTLTT 427 MGKGPGLYSDIGKRARDLLYKDY SD KFT+TT Sbjct: 1 MGKGPGLYSDIGKRARDLLYKDYQSDHKFTITT 33 >ref|XP_011652245.1| PREDICTED: mitochondrial outer membrane protein porin of 34 kDa [Cucumis sativus] gb|KGN59595.1| Porin [Cucumis sativus] Length = 276 Score = 67.0 bits (162), Expect = 2e-10 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +2 Query: 329 MGKGPGLYSDIGKRARDLLYKDYNSDQKFTLTT 427 MGKGPGLYSDIGKRARDLLYKDY SD KFT+TT Sbjct: 1 MGKGPGLYSDIGKRARDLLYKDYQSDHKFTITT 33 >gb|PNY05681.1| mitochondrial outer membrane protein porin [Trifolium pratense] Length = 276 Score = 66.6 bits (161), Expect = 3e-10 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = +2 Query: 329 MGKGPGLYSDIGKRARDLLYKDYNSDQKFTLTT 427 M KGPGLY+DIGK+ARDLLYKDYNSDQKFT+TT Sbjct: 1 MAKGPGLYTDIGKKARDLLYKDYNSDQKFTITT 33