BLASTX nr result
ID: Rehmannia31_contig00009727
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00009727 (912 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009606254.1| PREDICTED: small nuclear ribonucleoprotein E... 81 1e-15 gb|KHN17560.1| Small nuclear ribonucleoprotein E [Glycine soja] 79 2e-15 ref|XP_016578180.1| PREDICTED: small nuclear ribonucleoprotein E... 80 3e-15 ref|XP_016563944.1| PREDICTED: small nuclear ribonucleoprotein E... 80 3e-15 gb|KHN31189.1| Small nuclear ribonucleoprotein E [Glycine soja] 79 4e-15 ref|XP_021890705.1| small nuclear ribonucleoprotein E-like [Cari... 79 4e-15 ref|XP_009785390.1| PREDICTED: small nuclear ribonucleoprotein E... 79 4e-15 ref|XP_022888260.1| small nuclear ribonucleoprotein E-like [Olea... 79 6e-15 ref|XP_018820851.1| PREDICTED: small nuclear ribonucleoprotein E... 79 6e-15 ref|XP_011075202.1| small nuclear ribonucleoprotein E-like [Sesa... 79 6e-15 ref|XP_004241476.1| PREDICTED: small nuclear ribonucleoprotein E... 79 6e-15 ref|XP_003542280.1| PREDICTED: small nuclear ribonucleoprotein E... 79 6e-15 ref|XP_022156313.1| small nuclear ribonucleoprotein E-like [Momo... 79 8e-15 ref|XP_002522808.1| PREDICTED: small nuclear ribonucleoprotein E... 79 8e-15 ref|XP_003523208.1| PREDICTED: small nuclear ribonucleoprotein E... 79 8e-15 gb|ACU15277.1| unknown [Glycine max] 79 8e-15 dbj|GAU31043.1| hypothetical protein TSUD_214790 [Trifolium subt... 77 1e-14 gb|KHN09645.1| Small nuclear ribonucleoprotein E [Glycine soja] 79 1e-14 ref|XP_021665675.1| small nuclear ribonucleoprotein E-like [Heve... 78 1e-14 gb|PNS93596.1| hypothetical protein POPTR_018G096200v3 [Populus ... 78 1e-14 >ref|XP_009606254.1| PREDICTED: small nuclear ribonucleoprotein E-like [Nicotiana tomentosiformis] ref|XP_009592410.1| PREDICTED: small nuclear ribonucleoprotein E-like [Nicotiana tomentosiformis] ref|XP_009779979.1| PREDICTED: small nuclear ribonucleoprotein E-like [Nicotiana sylvestris] ref|XP_009786529.1| PREDICTED: small nuclear ribonucleoprotein E-like [Nicotiana sylvestris] ref|XP_016455853.1| PREDICTED: small nuclear ribonucleoprotein E-like [Nicotiana tabacum] ref|XP_016478942.1| PREDICTED: small nuclear ribonucleoprotein E-like [Nicotiana tabacum] ref|XP_016486023.1| PREDICTED: small nuclear ribonucleoprotein E-like [Nicotiana tabacum] ref|XP_016490718.1| PREDICTED: small nuclear ribonucleoprotein E-like [Nicotiana tabacum] ref|XP_019247790.1| PREDICTED: small nuclear ribonucleoprotein E-like [Nicotiana attenuata] ref|XP_019255952.1| PREDICTED: small nuclear ribonucleoprotein E-like [Nicotiana attenuata] Length = 88 Score = 80.9 bits (198), Expect = 1e-15 Identities = 39/40 (97%), Positives = 40/40 (100%) Frame = +2 Query: 2 YMNLVLDDAEEVNIKKKSRKQLGRILLKGDNITLMMNTGK 121 YMNLVLDDAEEVN+KKKSRKQLGRILLKGDNITLMMNTGK Sbjct: 49 YMNLVLDDAEEVNVKKKSRKQLGRILLKGDNITLMMNTGK 88 >gb|KHN17560.1| Small nuclear ribonucleoprotein E [Glycine soja] Length = 52 Score = 79.0 bits (193), Expect = 2e-15 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = +2 Query: 2 YMNLVLDDAEEVNIKKKSRKQLGRILLKGDNITLMMNTGK 121 YMNLVLDDAEEVNIKKKSRK LGRILLKGDNITLMMNTGK Sbjct: 13 YMNLVLDDAEEVNIKKKSRKTLGRILLKGDNITLMMNTGK 52 >ref|XP_016578180.1| PREDICTED: small nuclear ribonucleoprotein E-like [Capsicum annuum] Length = 88 Score = 79.7 bits (195), Expect = 3e-15 Identities = 38/40 (95%), Positives = 40/40 (100%) Frame = +2 Query: 2 YMNLVLDDAEEVNIKKKSRKQLGRILLKGDNITLMMNTGK 121 YMNLVLDDA+EVN+KKKSRKQLGRILLKGDNITLMMNTGK Sbjct: 49 YMNLVLDDADEVNVKKKSRKQLGRILLKGDNITLMMNTGK 88 >ref|XP_016563944.1| PREDICTED: small nuclear ribonucleoprotein E-like [Capsicum annuum] Length = 88 Score = 79.7 bits (195), Expect = 3e-15 Identities = 38/40 (95%), Positives = 40/40 (100%) Frame = +2 Query: 2 YMNLVLDDAEEVNIKKKSRKQLGRILLKGDNITLMMNTGK 121 YMNLVLDDAEEVN+KKK+RKQLGRILLKGDNITLMMNTGK Sbjct: 49 YMNLVLDDAEEVNVKKKTRKQLGRILLKGDNITLMMNTGK 88 >gb|KHN31189.1| Small nuclear ribonucleoprotein E [Glycine soja] Length = 58 Score = 78.6 bits (192), Expect = 4e-15 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = +2 Query: 2 YMNLVLDDAEEVNIKKKSRKQLGRILLKGDNITLMMNTGK 121 YMNLVLDDAEEVN+KKKSRK LGRILLKGDNITLMMNTGK Sbjct: 19 YMNLVLDDAEEVNVKKKSRKTLGRILLKGDNITLMMNTGK 58 >ref|XP_021890705.1| small nuclear ribonucleoprotein E-like [Carica papaya] Length = 88 Score = 79.3 bits (194), Expect = 4e-15 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = +2 Query: 2 YMNLVLDDAEEVNIKKKSRKQLGRILLKGDNITLMMNTGK 121 YMNLVLDDAEEVNIKKKSRK LGRILLKGDNITLMMNTGK Sbjct: 49 YMNLVLDDAEEVNIKKKSRKSLGRILLKGDNITLMMNTGK 88 >ref|XP_009785390.1| PREDICTED: small nuclear ribonucleoprotein E-like [Nicotiana sylvestris] ref|XP_016445627.1| PREDICTED: small nuclear ribonucleoprotein E-like [Nicotiana tabacum] Length = 88 Score = 79.3 bits (194), Expect = 4e-15 Identities = 38/40 (95%), Positives = 40/40 (100%) Frame = +2 Query: 2 YMNLVLDDAEEVNIKKKSRKQLGRILLKGDNITLMMNTGK 121 YMNLVLDDAEEVN+KKKSRKQLG+ILLKGDNITLMMNTGK Sbjct: 49 YMNLVLDDAEEVNVKKKSRKQLGQILLKGDNITLMMNTGK 88 >ref|XP_022888260.1| small nuclear ribonucleoprotein E-like [Olea europaea var. sylvestris] ref|XP_022888261.1| small nuclear ribonucleoprotein E-like [Olea europaea var. sylvestris] Length = 88 Score = 79.0 bits (193), Expect = 6e-15 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = +2 Query: 2 YMNLVLDDAEEVNIKKKSRKQLGRILLKGDNITLMMNTGK 121 YMNLVLDDAEEVN+KK SRKQLGRILLKGDNITLMMNTGK Sbjct: 49 YMNLVLDDAEEVNVKKNSRKQLGRILLKGDNITLMMNTGK 88 >ref|XP_018820851.1| PREDICTED: small nuclear ribonucleoprotein E-like [Juglans regia] ref|XP_018831159.1| PREDICTED: small nuclear ribonucleoprotein E-like [Juglans regia] Length = 88 Score = 79.0 bits (193), Expect = 6e-15 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = +2 Query: 2 YMNLVLDDAEEVNIKKKSRKQLGRILLKGDNITLMMNTGK 121 YMNLVLDDAEEVN+KKKSRK LGRILLKGDNITLMMNTGK Sbjct: 49 YMNLVLDDAEEVNVKKKSRKSLGRILLKGDNITLMMNTGK 88 >ref|XP_011075202.1| small nuclear ribonucleoprotein E-like [Sesamum indicum] ref|XP_019194573.1| PREDICTED: small nuclear ribonucleoprotein E-like [Ipomoea nil] ref|XP_020554778.1| small nuclear ribonucleoprotein E-like [Sesamum indicum] Length = 88 Score = 79.0 bits (193), Expect = 6e-15 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = +2 Query: 2 YMNLVLDDAEEVNIKKKSRKQLGRILLKGDNITLMMNTGK 121 YMNLVLDDAEEVN+KK SRKQLGRILLKGDNITLMMNTGK Sbjct: 49 YMNLVLDDAEEVNVKKNSRKQLGRILLKGDNITLMMNTGK 88 >ref|XP_004241476.1| PREDICTED: small nuclear ribonucleoprotein E [Solanum lycopersicum] ref|XP_006347373.1| PREDICTED: small nuclear ribonucleoprotein E-like [Solanum tuberosum] ref|XP_015077660.1| PREDICTED: small nuclear ribonucleoprotein E-like [Solanum pennellii] Length = 88 Score = 79.0 bits (193), Expect = 6e-15 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = +2 Query: 2 YMNLVLDDAEEVNIKKKSRKQLGRILLKGDNITLMMNTGK 121 YMNLVLDDAEEVN+KK SRKQLGRILLKGDNITLMMNTGK Sbjct: 49 YMNLVLDDAEEVNVKKNSRKQLGRILLKGDNITLMMNTGK 88 >ref|XP_003542280.1| PREDICTED: small nuclear ribonucleoprotein E [Glycine max] gb|ACU14300.1| unknown [Glycine max] gb|KHN34786.1| Small nuclear ribonucleoprotein E [Glycine soja] gb|KRH18975.1| hypothetical protein GLYMA_13G093400 [Glycine max] Length = 88 Score = 79.0 bits (193), Expect = 6e-15 Identities = 39/40 (97%), Positives = 39/40 (97%) Frame = +2 Query: 2 YMNLVLDDAEEVNIKKKSRKQLGRILLKGDNITLMMNTGK 121 YMNLVLDDAEEVNIKKKSRK LGRILLKGDNITLMMNTGK Sbjct: 49 YMNLVLDDAEEVNIKKKSRKTLGRILLKGDNITLMMNTGK 88 >ref|XP_022156313.1| small nuclear ribonucleoprotein E-like [Momordica charantia] ref|XP_022156314.1| small nuclear ribonucleoprotein E-like [Momordica charantia] Length = 88 Score = 78.6 bits (192), Expect = 8e-15 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = +2 Query: 2 YMNLVLDDAEEVNIKKKSRKQLGRILLKGDNITLMMNTGK 121 YMNLVLDDAEEVN+KKKSRK LGRILLKGDNITLMMNTGK Sbjct: 49 YMNLVLDDAEEVNVKKKSRKTLGRILLKGDNITLMMNTGK 88 >ref|XP_002522808.1| PREDICTED: small nuclear ribonucleoprotein E [Ricinus communis] gb|EEF39659.1| Small nuclear ribonucleoprotein E, putative [Ricinus communis] Length = 88 Score = 78.6 bits (192), Expect = 8e-15 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = +2 Query: 2 YMNLVLDDAEEVNIKKKSRKQLGRILLKGDNITLMMNTGK 121 YMNLVLDDAEEVN+KKKSRK LGRILLKGDNITLMMNTGK Sbjct: 49 YMNLVLDDAEEVNVKKKSRKTLGRILLKGDNITLMMNTGK 88 >ref|XP_003523208.1| PREDICTED: small nuclear ribonucleoprotein E [Glycine max] ref|XP_003526883.1| PREDICTED: small nuclear ribonucleoprotein E [Glycine max] ref|XP_004491225.1| PREDICTED: small nuclear ribonucleoprotein E-like [Cicer arietinum] ref|XP_019442203.1| PREDICTED: small nuclear ribonucleoprotein E-like isoform X1 [Lupinus angustifolius] ref|XP_019454008.1| PREDICTED: small nuclear ribonucleoprotein E-like [Lupinus angustifolius] ref|XP_019436197.1| PREDICTED: small nuclear ribonucleoprotein E-like isoform X1 [Lupinus angustifolius] gb|AFK38926.1| unknown [Lotus japonicus] gb|KRH53956.1| hypothetical protein GLYMA_06G157100 [Glycine max] gb|KRH63981.1| hypothetical protein GLYMA_04G208600 [Glycine max] gb|OIW18657.1| hypothetical protein TanjilG_13409 [Lupinus angustifolius] gb|OIW19447.1| hypothetical protein TanjilG_09467 [Lupinus angustifolius] Length = 88 Score = 78.6 bits (192), Expect = 8e-15 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = +2 Query: 2 YMNLVLDDAEEVNIKKKSRKQLGRILLKGDNITLMMNTGK 121 YMNLVLDDAEEVN+KKKSRK LGRILLKGDNITLMMNTGK Sbjct: 49 YMNLVLDDAEEVNVKKKSRKTLGRILLKGDNITLMMNTGK 88 >gb|ACU15277.1| unknown [Glycine max] Length = 88 Score = 78.6 bits (192), Expect = 8e-15 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = +2 Query: 2 YMNLVLDDAEEVNIKKKSRKQLGRILLKGDNITLMMNTGK 121 YMNLVLDDAEEVN+KKKSRK LGRILLKGDNITLMMNTGK Sbjct: 49 YMNLVLDDAEEVNVKKKSRKTLGRILLKGDNITLMMNTGK 88 >dbj|GAU31043.1| hypothetical protein TSUD_214790 [Trifolium subterraneum] Length = 60 Score = 77.4 bits (189), Expect = 1e-14 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = +2 Query: 2 YMNLVLDDAEEVNIKKKSRKQLGRILLKGDNITLMMNTGK 121 YMNLVLDDAEEVN+KKKS+K LGRILLKGDNITLMMNTGK Sbjct: 21 YMNLVLDDAEEVNVKKKSKKTLGRILLKGDNITLMMNTGK 60 >gb|KHN09645.1| Small nuclear ribonucleoprotein E [Glycine soja] Length = 98 Score = 78.6 bits (192), Expect = 1e-14 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = +2 Query: 2 YMNLVLDDAEEVNIKKKSRKQLGRILLKGDNITLMMNTGK 121 YMNLVLDDAEEVN+KKKSRK LGRILLKGDNITLMMNTGK Sbjct: 59 YMNLVLDDAEEVNVKKKSRKTLGRILLKGDNITLMMNTGK 98 >ref|XP_021665675.1| small nuclear ribonucleoprotein E-like [Hevea brasiliensis] ref|XP_021677131.1| small nuclear ribonucleoprotein E-like [Hevea brasiliensis] gb|ADR71258.1| small nuclear ribonucleoprotein E [Hevea brasiliensis] Length = 88 Score = 78.2 bits (191), Expect = 1e-14 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = +2 Query: 2 YMNLVLDDAEEVNIKKKSRKQLGRILLKGDNITLMMNTGK 121 YMNLVLDDAEEVNIKKK+RK LGRILLKGDNITLMMNTGK Sbjct: 49 YMNLVLDDAEEVNIKKKTRKSLGRILLKGDNITLMMNTGK 88 >gb|PNS93596.1| hypothetical protein POPTR_018G096200v3 [Populus trichocarpa] Length = 79 Score = 77.8 bits (190), Expect = 1e-14 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = +2 Query: 2 YMNLVLDDAEEVNIKKKSRKQLGRILLKGDNITLMMNTGK 121 YMNLVL+DAEEVNIKKKSRK LGRILLKGDNITLMMNTGK Sbjct: 40 YMNLVLEDAEEVNIKKKSRKSLGRILLKGDNITLMMNTGK 79