BLASTX nr result
ID: Rehmannia31_contig00009142
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00009142 (352 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU35669.1| hypothetical protein MIMGU_mgv1a015417mg [Erythra... 93 1e-21 gb|EYU35668.1| hypothetical protein MIMGU_mgv1a015413mg [Erythra... 93 2e-21 >gb|EYU35669.1| hypothetical protein MIMGU_mgv1a015417mg [Erythranthe guttata] Length = 158 Score = 93.2 bits (230), Expect = 1e-21 Identities = 43/61 (70%), Positives = 50/61 (81%) Frame = -3 Query: 347 LGQATTNVNGSFNITVPALAGLILGFPILPCVTTVQLPLNSVVCPVLSTTNGILASAIRS 168 LG TNVNGSFNITVPA+ GLILG P+LPCV TVQLPL+ VVCPVL+ T GILA+ + S Sbjct: 74 LGSGITNVNGSFNITVPAITGLILGLPMLPCVVTVQLPLSPVVCPVLNATTGILAATVNS 133 Query: 167 V 165 + Sbjct: 134 I 134 >gb|EYU35668.1| hypothetical protein MIMGU_mgv1a015413mg [Erythranthe guttata] Length = 158 Score = 92.8 bits (229), Expect = 2e-21 Identities = 43/61 (70%), Positives = 50/61 (81%) Frame = -3 Query: 347 LGQATTNVNGSFNITVPALAGLILGFPILPCVTTVQLPLNSVVCPVLSTTNGILASAIRS 168 LG TNVNGSFNITVPA+ GLILG P+LPCV TVQLPL+ VVCPV++ T GILA+ + S Sbjct: 74 LGSGITNVNGSFNITVPAITGLILGLPMLPCVVTVQLPLSPVVCPVINATTGILAATVNS 133 Query: 167 V 165 V Sbjct: 134 V 134