BLASTX nr result
ID: Rehmannia31_contig00008949
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00008949 (373 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011092754.1| mitochondrial import receptor subunit TOM6 h... 108 5e-29 gb|PIN12367.1| hypothetical protein CDL12_15020 [Handroanthus im... 107 2e-28 gb|KHF97675.1| Mitochondrial import receptor subunit TOM6 -like ... 105 4e-27 ref|XP_022148517.1| mitochondrial import receptor subunit TOM6 h... 102 1e-26 ref|XP_021284689.1| mitochondrial import receptor subunit TOM6 h... 102 1e-26 ref|XP_012458101.1| PREDICTED: mitochondrial import receptor sub... 102 1e-26 ref|XP_015063655.1| PREDICTED: mitochondrial import receptor sub... 102 2e-26 ref|XP_022861050.1| mitochondrial import receptor subunit TOM6 h... 101 4e-26 gb|PIM97556.1| hypothetical protein CDL12_29973 [Handroanthus im... 101 4e-26 ref|XP_012458102.1| PREDICTED: mitochondrial import receptor sub... 101 4e-26 ref|XP_017981499.1| PREDICTED: mitochondrial import receptor sub... 101 4e-26 ref|XP_004154290.1| PREDICTED: mitochondrial import receptor sub... 101 4e-26 ref|XP_021300333.1| mitochondrial import receptor subunit TOM6 h... 101 6e-26 gb|OAY25470.1| hypothetical protein MANES_17G097600 [Manihot esc... 101 6e-26 gb|OAY29459.1| hypothetical protein MANES_15G146500 [Manihot esc... 100 8e-26 ref|XP_009596562.1| PREDICTED: mitochondrial import receptor sub... 100 8e-26 ref|XP_004230848.1| PREDICTED: mitochondrial import receptor sub... 100 1e-25 ref|XP_022762816.1| mitochondrial import receptor subunit TOM6 h... 100 2e-25 ref|XP_016679716.1| PREDICTED: mitochondrial import receptor sub... 100 2e-25 ref|XP_016539703.1| PREDICTED: mitochondrial import receptor sub... 100 2e-25 >ref|XP_011092754.1| mitochondrial import receptor subunit TOM6 homolog [Sesamum indicum] Length = 54 Score = 108 bits (271), Expect = 5e-29 Identities = 50/54 (92%), Positives = 54/54 (100%) Frame = +2 Query: 59 MFPGMFMRKPDKAAALKQLKSHVAMFGVWVAVVRVTPYLLHYFSDQNEELKLEI 220 MFPG+FMRKPDKAAA+KQLKSHVAMFGVWVAVVRVTPYLLHYFSDQNEELKL++ Sbjct: 1 MFPGLFMRKPDKAAAIKQLKSHVAMFGVWVAVVRVTPYLLHYFSDQNEELKLDL 54 >gb|PIN12367.1| hypothetical protein CDL12_15020 [Handroanthus impetiginosus] Length = 54 Score = 107 bits (268), Expect = 2e-28 Identities = 49/54 (90%), Positives = 53/54 (98%) Frame = +2 Query: 59 MFPGMFMRKPDKAAALKQLKSHVAMFGVWVAVVRVTPYLLHYFSDQNEELKLEI 220 MFPGMF+RKPDKA ALKQLKSHVAMFGVWVAV+RVTPY+LHYFSDQNEELKLE+ Sbjct: 1 MFPGMFIRKPDKAVALKQLKSHVAMFGVWVAVIRVTPYILHYFSDQNEELKLEL 54 >gb|KHF97675.1| Mitochondrial import receptor subunit TOM6 -like protein [Gossypium arboreum] Length = 93 Score = 105 bits (262), Expect = 4e-27 Identities = 54/81 (66%), Positives = 62/81 (76%) Frame = +2 Query: 59 MFPGMFMRKPDKAAALKQLKSHVAMFGVWVAVVRVTPYLLHYFSDQNEELKLEI*FCHCF 238 MFPGMFMRKPDKAAALKQLK+HVAMFGVWVAVVRVTPY+LHY SD+ EELK+E Sbjct: 1 MFPGMFMRKPDKAAALKQLKAHVAMFGVWVAVVRVTPYILHYLSDEKEELKIE------- 53 Query: 239 YLSFYTDLEGAESRYLYICLV 301 S + E + S Y +ICL+ Sbjct: 54 --SRFNSYE-SHSSYPFICLI 71 >ref|XP_022148517.1| mitochondrial import receptor subunit TOM6 homolog [Momordica charantia] Length = 54 Score = 102 bits (255), Expect = 1e-26 Identities = 47/53 (88%), Positives = 51/53 (96%) Frame = +2 Query: 59 MFPGMFMRKPDKAAALKQLKSHVAMFGVWVAVVRVTPYLLHYFSDQNEELKLE 217 MFPGMFMRKPDKAAALKQL+SHVAMFGVWVAV+RVTPY+LHY SD+ EELKLE Sbjct: 1 MFPGMFMRKPDKAAALKQLRSHVAMFGVWVAVIRVTPYVLHYLSDEKEELKLE 53 >ref|XP_021284689.1| mitochondrial import receptor subunit TOM6 homolog [Herrania umbratica] ref|XP_021284690.1| mitochondrial import receptor subunit TOM6 homolog [Herrania umbratica] Length = 54 Score = 102 bits (255), Expect = 1e-26 Identities = 48/53 (90%), Positives = 50/53 (94%) Frame = +2 Query: 59 MFPGMFMRKPDKAAALKQLKSHVAMFGVWVAVVRVTPYLLHYFSDQNEELKLE 217 MFPGMFMRKPDKAAALKQLK+HVAMFGVWVAVVRVTPY+LHY SD EELKLE Sbjct: 1 MFPGMFMRKPDKAAALKQLKAHVAMFGVWVAVVRVTPYILHYLSDDKEELKLE 53 >ref|XP_012458101.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Gossypium raimondii] ref|XP_016731270.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Gossypium hirsutum] ref|XP_017613195.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Gossypium arboreum] gb|KJB77892.1| hypothetical protein B456_012G163800 [Gossypium raimondii] Length = 54 Score = 102 bits (255), Expect = 1e-26 Identities = 47/53 (88%), Positives = 51/53 (96%) Frame = +2 Query: 59 MFPGMFMRKPDKAAALKQLKSHVAMFGVWVAVVRVTPYLLHYFSDQNEELKLE 217 MFPGMFMRKPDKAAALKQLK+HVAMFGVWVAVVRVTPY+LHY SD+ EELK+E Sbjct: 1 MFPGMFMRKPDKAAALKQLKAHVAMFGVWVAVVRVTPYILHYLSDEKEELKIE 53 >ref|XP_015063655.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Solanum pennellii] Length = 54 Score = 102 bits (254), Expect = 2e-26 Identities = 46/53 (86%), Positives = 50/53 (94%) Frame = +2 Query: 59 MFPGMFMRKPDKAAALKQLKSHVAMFGVWVAVVRVTPYLLHYFSDQNEELKLE 217 MFPGMFMRKPDKAAALKQLK+HV +FG WVAV+RVTPY+LHYFSDQ EELKLE Sbjct: 1 MFPGMFMRKPDKAAALKQLKTHVVLFGTWVAVIRVTPYILHYFSDQKEELKLE 53 >ref|XP_022861050.1| mitochondrial import receptor subunit TOM6 homolog [Olea europaea var. sylvestris] Length = 54 Score = 101 bits (252), Expect = 4e-26 Identities = 46/54 (85%), Positives = 50/54 (92%) Frame = +2 Query: 59 MFPGMFMRKPDKAAALKQLKSHVAMFGVWVAVVRVTPYLLHYFSDQNEELKLEI 220 MFPGMFMRKPDKA ALKQLK+H AMFGVWVAV+RVTPY+LHYFSD EELKLE+ Sbjct: 1 MFPGMFMRKPDKAEALKQLKTHAAMFGVWVAVIRVTPYVLHYFSDSKEELKLEL 54 >gb|PIM97556.1| hypothetical protein CDL12_29973 [Handroanthus impetiginosus] Length = 54 Score = 101 bits (252), Expect = 4e-26 Identities = 45/54 (83%), Positives = 50/54 (92%) Frame = +2 Query: 59 MFPGMFMRKPDKAAALKQLKSHVAMFGVWVAVVRVTPYLLHYFSDQNEELKLEI 220 MFPGMF+RKPDKA ALKQLK HVAMFG WV V+RVTPY+LHYFS+QNEELKLE+ Sbjct: 1 MFPGMFIRKPDKAVALKQLKKHVAMFGAWVVVIRVTPYILHYFSEQNEELKLEL 54 >ref|XP_012458102.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Gossypium raimondii] ref|XP_012458103.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Gossypium raimondii] ref|XP_016731271.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Gossypium hirsutum] ref|XP_016731272.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Gossypium hirsutum] ref|XP_016679715.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Gossypium hirsutum] ref|XP_017614239.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Gossypium arboreum] ref|XP_017614240.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Gossypium arboreum] gb|KJB77893.1| hypothetical protein B456_012G163900 [Gossypium raimondii] Length = 54 Score = 101 bits (252), Expect = 4e-26 Identities = 47/53 (88%), Positives = 50/53 (94%) Frame = +2 Query: 59 MFPGMFMRKPDKAAALKQLKSHVAMFGVWVAVVRVTPYLLHYFSDQNEELKLE 217 MFPGMFMRKPDKAAALKQLK HVAMFGVWVAVVRVTPY+LHY SD+ EELK+E Sbjct: 1 MFPGMFMRKPDKAAALKQLKVHVAMFGVWVAVVRVTPYILHYLSDEKEELKIE 53 >ref|XP_017981499.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Theobroma cacao] gb|EOY16388.1| Translocase of the outer mitochondrial membrane 6 [Theobroma cacao] Length = 54 Score = 101 bits (252), Expect = 4e-26 Identities = 48/53 (90%), Positives = 49/53 (92%) Frame = +2 Query: 59 MFPGMFMRKPDKAAALKQLKSHVAMFGVWVAVVRVTPYLLHYFSDQNEELKLE 217 MFPGMFMRKPDKAAALKQLK HVAMFGVWVAVVRVTPY+LHY SD EELKLE Sbjct: 1 MFPGMFMRKPDKAAALKQLKVHVAMFGVWVAVVRVTPYILHYLSDDKEELKLE 53 >ref|XP_004154290.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] ref|XP_008459248.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis melo] ref|XP_011649217.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] ref|XP_022943932.1| mitochondrial import receptor subunit TOM6 homolog [Cucurbita moschata] ref|XP_022943933.1| mitochondrial import receptor subunit TOM6 homolog [Cucurbita moschata] ref|XP_022948071.1| mitochondrial import receptor subunit TOM6 homolog [Cucurbita moschata] ref|XP_022986654.1| mitochondrial import receptor subunit TOM6 homolog [Cucurbita maxima] ref|XP_022986655.1| mitochondrial import receptor subunit TOM6 homolog [Cucurbita maxima] ref|XP_022986656.1| mitochondrial import receptor subunit TOM6 homolog [Cucurbita maxima] ref|XP_023007537.1| mitochondrial import receptor subunit TOM6 homolog [Cucurbita maxima] ref|XP_023532551.1| mitochondrial import receptor subunit TOM6 homolog [Cucurbita pepo subsp. pepo] ref|XP_023511843.1| mitochondrial import receptor subunit TOM6 homolog [Cucurbita pepo subsp. pepo] ref|XP_023511844.1| mitochondrial import receptor subunit TOM6 homolog [Cucurbita pepo subsp. pepo] gb|KGN61761.1| hypothetical protein Csa_2G238770 [Cucumis sativus] Length = 54 Score = 101 bits (252), Expect = 4e-26 Identities = 46/53 (86%), Positives = 51/53 (96%) Frame = +2 Query: 59 MFPGMFMRKPDKAAALKQLKSHVAMFGVWVAVVRVTPYLLHYFSDQNEELKLE 217 MFPGMFMRKPDKAAALKQL+SHVAMFGVWVAV+RVTPY+LHY SD+ EELKL+ Sbjct: 1 MFPGMFMRKPDKAAALKQLRSHVAMFGVWVAVIRVTPYVLHYLSDEKEELKLD 53 >ref|XP_021300333.1| mitochondrial import receptor subunit TOM6 homolog [Herrania umbratica] Length = 54 Score = 101 bits (251), Expect = 6e-26 Identities = 47/53 (88%), Positives = 50/53 (94%) Frame = +2 Query: 59 MFPGMFMRKPDKAAALKQLKSHVAMFGVWVAVVRVTPYLLHYFSDQNEELKLE 217 MFPGMFMRKPDKAAALKQLK+HVAMFGVWVAVVRV+PY+LHY SD EELKLE Sbjct: 1 MFPGMFMRKPDKAAALKQLKAHVAMFGVWVAVVRVSPYILHYLSDDKEELKLE 53 >gb|OAY25470.1| hypothetical protein MANES_17G097600 [Manihot esculenta] Length = 54 Score = 101 bits (251), Expect = 6e-26 Identities = 46/53 (86%), Positives = 51/53 (96%) Frame = +2 Query: 59 MFPGMFMRKPDKAAALKQLKSHVAMFGVWVAVVRVTPYLLHYFSDQNEELKLE 217 MFPGMFMRKPDKAAALKQLK+HV+MFGVWVAVVRVTPY+LHY SD+ +ELKLE Sbjct: 1 MFPGMFMRKPDKAAALKQLKTHVSMFGVWVAVVRVTPYILHYLSDEKDELKLE 53 >gb|OAY29459.1| hypothetical protein MANES_15G146500 [Manihot esculenta] Length = 54 Score = 100 bits (250), Expect = 8e-26 Identities = 46/53 (86%), Positives = 51/53 (96%) Frame = +2 Query: 59 MFPGMFMRKPDKAAALKQLKSHVAMFGVWVAVVRVTPYLLHYFSDQNEELKLE 217 MFPGMFMRKPDKAAALKQLK+HVAMFGVWVAVVRVTPY+LH+ SD+ +ELKLE Sbjct: 1 MFPGMFMRKPDKAAALKQLKTHVAMFGVWVAVVRVTPYILHFLSDEKDELKLE 53 >ref|XP_009596562.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Nicotiana tomentosiformis] ref|XP_009791420.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Nicotiana sylvestris] ref|XP_016446195.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Nicotiana tabacum] ref|XP_016477444.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Nicotiana tabacum] ref|XP_016477445.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Nicotiana tabacum] ref|XP_019249059.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Nicotiana attenuata] Length = 54 Score = 100 bits (250), Expect = 8e-26 Identities = 45/54 (83%), Positives = 51/54 (94%) Frame = +2 Query: 59 MFPGMFMRKPDKAAALKQLKSHVAMFGVWVAVVRVTPYLLHYFSDQNEELKLEI 220 MFPG+FMRKPDKAAALKQLK+HVA+FG WVAV+RVTPY+LHYFSDQ EEL LE+ Sbjct: 1 MFPGLFMRKPDKAAALKQLKTHVALFGAWVAVIRVTPYILHYFSDQKEELLLEL 54 >ref|XP_004230848.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Solanum lycopersicum] ref|XP_006365492.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Solanum tuberosum] Length = 54 Score = 100 bits (249), Expect = 1e-25 Identities = 45/53 (84%), Positives = 49/53 (92%) Frame = +2 Query: 59 MFPGMFMRKPDKAAALKQLKSHVAMFGVWVAVVRVTPYLLHYFSDQNEELKLE 217 MFPGMFMRKPDKAAALKQLK+HV +FG WVAV+RV PY+LHYFSDQ EELKLE Sbjct: 1 MFPGMFMRKPDKAAALKQLKTHVVLFGTWVAVIRVAPYILHYFSDQKEELKLE 53 >ref|XP_022762816.1| mitochondrial import receptor subunit TOM6 homolog [Durio zibethinus] Length = 54 Score = 100 bits (248), Expect = 2e-25 Identities = 45/53 (84%), Positives = 49/53 (92%) Frame = +2 Query: 59 MFPGMFMRKPDKAAALKQLKSHVAMFGVWVAVVRVTPYLLHYFSDQNEELKLE 217 MFPGMFMRKPDKA ALKQLK+HVAMFGVW+AV+RVTPY+LHY SD EELKLE Sbjct: 1 MFPGMFMRKPDKAVALKQLKAHVAMFGVWIAVIRVTPYVLHYLSDDKEELKLE 53 >ref|XP_016679716.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Gossypium hirsutum] Length = 54 Score = 100 bits (248), Expect = 2e-25 Identities = 46/53 (86%), Positives = 50/53 (94%) Frame = +2 Query: 59 MFPGMFMRKPDKAAALKQLKSHVAMFGVWVAVVRVTPYLLHYFSDQNEELKLE 217 MFPGMFM KPDKAAALKQLK+HVAMFGVWVAVVRVTPY+LHY SD+ EELK+E Sbjct: 1 MFPGMFMPKPDKAAALKQLKAHVAMFGVWVAVVRVTPYILHYLSDEKEELKIE 53 >ref|XP_016539703.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog isoform X2 [Capsicum annuum] ref|XP_016539705.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog isoform X2 [Capsicum annuum] gb|PHT64434.1| Mitochondrial import receptor subunit TOM6 -like protein [Capsicum annuum] gb|PHU10563.1| Mitochondrial import receptor subunit TOM6 -like protein [Capsicum chinense] Length = 54 Score = 100 bits (248), Expect = 2e-25 Identities = 44/53 (83%), Positives = 49/53 (92%) Frame = +2 Query: 59 MFPGMFMRKPDKAAALKQLKSHVAMFGVWVAVVRVTPYLLHYFSDQNEELKLE 217 MFPGMFMRKPDKAAALKQLK+HVA+FG WV +RVTPY+LHYFSD NEELKL+ Sbjct: 1 MFPGMFMRKPDKAAALKQLKTHVALFGAWVVAIRVTPYILHYFSDHNEELKLD 53