BLASTX nr result
ID: Rehmannia31_contig00008816
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00008816 (393 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011076404.1| hexose carrier protein HEX6 [Sesamum indicum] 75 3e-13 ref|XP_011076401.1| hexose carrier protein HEX6-like [Sesamum in... 75 3e-13 ref|XP_011076405.1| hexose carrier protein HEX6 [Sesamum indicum] 73 3e-12 gb|EPS60332.1| hypothetical protein M569_14469, partial [Genlise... 72 5e-12 gb|PIA34384.1| hypothetical protein AQUCO_03800179v1 [Aquilegia ... 70 2e-11 ref|XP_006644257.1| PREDICTED: sugar carrier protein C-like [Ory... 69 4e-11 gb|EAZ12378.1| hypothetical protein OsJ_02267 [Oryza sativa Japo... 64 5e-11 ref|XP_022863739.1| hexose carrier protein HEX6-like [Olea europ... 68 1e-10 ref|XP_012858301.1| PREDICTED: hexose carrier protein HEX6-like ... 68 1e-10 ref|XP_024170898.1| hexose carrier protein HEX6-like [Rosa chine... 68 1e-10 ref|XP_021616936.1| hexose carrier protein HEX6 [Manihot esculen... 68 1e-10 ref|XP_003566793.3| PREDICTED: sugar transport protein 1-like [B... 68 1e-10 ref|XP_024199315.1| sugar carrier protein C-like [Rosa chinensis... 68 1e-10 ref|XP_009374920.1| PREDICTED: sugar carrier protein C [Pyrus x ... 68 1e-10 ref|XP_004293542.1| PREDICTED: sugar carrier protein C [Fragaria... 68 1e-10 gb|KVI10099.1| General substrate transporter [Cynara cardunculus... 68 1e-10 gb|KMT00388.1| hypothetical protein BVRB_9g216930 [Beta vulgaris... 67 2e-10 gb|PON70922.1| Sugar/inositol transporter [Parasponia andersonii] 67 2e-10 ref|XP_024157209.1| sugar carrier protein C-like [Rosa chinensis... 67 2e-10 ref|XP_010691744.1| PREDICTED: sugar carrier protein C-like [Bet... 67 2e-10 >ref|XP_011076404.1| hexose carrier protein HEX6 [Sesamum indicum] Length = 510 Score = 75.5 bits (184), Expect = 3e-13 Identities = 36/50 (72%), Positives = 40/50 (80%), Gaps = 4/50 (8%) Frame = -1 Query: 393 LLMSVFVYFLLPETKGIPIEKMDQIWGEHFFWKRFV----SHEDSKLEAA 256 LLMS FVY LLPETK IPIEKMDQIWG+HFFWK+F+ S E +K EAA Sbjct: 461 LLMSAFVYLLLPETKNIPIEKMDQIWGKHFFWKKFMDSSQSRESNKTEAA 510 >ref|XP_011076401.1| hexose carrier protein HEX6-like [Sesamum indicum] ref|XP_011076403.1| hexose carrier protein HEX6-like [Sesamum indicum] Length = 510 Score = 75.5 bits (184), Expect = 3e-13 Identities = 36/50 (72%), Positives = 41/50 (82%), Gaps = 4/50 (8%) Frame = -1 Query: 393 LLMSVFVYFLLPETKGIPIEKMDQIWGEHFFWKRFV----SHEDSKLEAA 256 ++MS FVYFLLPETK IPIEKM++IWGEHFFWKRFV S E K+EAA Sbjct: 461 VVMSGFVYFLLPETKNIPIEKMEKIWGEHFFWKRFVDSSQSEEGGKIEAA 510 >ref|XP_011076405.1| hexose carrier protein HEX6 [Sesamum indicum] Length = 512 Score = 72.8 bits (177), Expect = 3e-12 Identities = 34/52 (65%), Positives = 39/52 (75%), Gaps = 6/52 (11%) Frame = -1 Query: 393 LLMSVFVYFLLPETKGIPIEKMDQIWGEHFFWKRFVSH------EDSKLEAA 256 ++MSVF+YFLLPETK IPIEKMD+IW EHFFWKR + ED K EAA Sbjct: 461 VVMSVFIYFLLPETKNIPIEKMDKIWKEHFFWKRVIGESEYEVPEDKKFEAA 512 >gb|EPS60332.1| hypothetical protein M569_14469, partial [Genlisea aurea] Length = 497 Score = 72.0 bits (175), Expect = 5e-12 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = -1 Query: 393 LLMSVFVYFLLPETKGIPIEKMDQIWGEHFFWKRFV 286 L MS+FVY LLPETKGIPIEKMD+IW EHFFWKRF+ Sbjct: 462 LTMSIFVYLLLPETKGIPIEKMDKIWAEHFFWKRFI 497 >gb|PIA34384.1| hypothetical protein AQUCO_03800179v1 [Aquilegia coerulea] gb|PIA34385.1| hypothetical protein AQUCO_03800179v1 [Aquilegia coerulea] Length = 515 Score = 70.1 bits (170), Expect = 2e-11 Identities = 29/44 (65%), Positives = 37/44 (84%) Frame = -1 Query: 393 LLMSVFVYFLLPETKGIPIEKMDQIWGEHFFWKRFVSHEDSKLE 262 ++MSVFVYF LPETKGIPIE+M Q+W H++WKRFV E+ +LE Sbjct: 464 VIMSVFVYFFLPETKGIPIEEMSQVWKTHWYWKRFVDDEEYELE 507 >ref|XP_006644257.1| PREDICTED: sugar carrier protein C-like [Oryza brachyantha] Length = 514 Score = 69.3 bits (168), Expect = 4e-11 Identities = 30/47 (63%), Positives = 40/47 (85%), Gaps = 1/47 (2%) Frame = -1 Query: 393 LLMSVFVYFLLPETKGIPIEKMDQIWGEHFFWKRFVSHE-DSKLEAA 256 L+M+ FVYF LPETKGIPIE+MD+IWG+H++W+RFV + D K+E A Sbjct: 464 LVMTAFVYFFLPETKGIPIEEMDRIWGKHWYWRRFVDGDGDRKVEMA 510 >gb|EAZ12378.1| hypothetical protein OsJ_02267 [Oryza sativa Japonica Group] Length = 80 Score = 64.3 bits (155), Expect = 5e-11 Identities = 25/36 (69%), Positives = 34/36 (94%) Frame = -1 Query: 393 LLMSVFVYFLLPETKGIPIEKMDQIWGEHFFWKRFV 286 L+M+ FV+F LPETKGIPIE+MD+IWG+H++W+RFV Sbjct: 31 LIMTGFVFFFLPETKGIPIEEMDRIWGKHWYWRRFV 66 >ref|XP_022863739.1| hexose carrier protein HEX6-like [Olea europaea var. sylvestris] Length = 510 Score = 68.2 bits (165), Expect = 1e-10 Identities = 33/49 (67%), Positives = 37/49 (75%), Gaps = 4/49 (8%) Frame = -1 Query: 390 LMSVFVYFLLPETKGIPIEKMDQIWGEHFFWKRFV----SHEDSKLEAA 256 LM+ FVYF LPETK IPIEKM++IWGEH FWKRFV +E SK E A Sbjct: 462 LMTGFVYFFLPETKNIPIEKMEKIWGEHTFWKRFVPCNQDNEKSKTEVA 510 >ref|XP_012858301.1| PREDICTED: hexose carrier protein HEX6-like [Erythranthe guttata] gb|EYU20200.1| hypothetical protein MIMGU_mgv1a004758mg [Erythranthe guttata] Length = 511 Score = 68.2 bits (165), Expect = 1e-10 Identities = 29/42 (69%), Positives = 36/42 (85%) Frame = -1 Query: 390 LMSVFVYFLLPETKGIPIEKMDQIWGEHFFWKRFVSHEDSKL 265 +M+VFVYFLLPETK IPIE+MD IW EH+FWKRFV ++ K+ Sbjct: 463 VMTVFVYFLLPETKNIPIEQMDGIWREHWFWKRFVGGDNKKV 504 >ref|XP_024170898.1| hexose carrier protein HEX6-like [Rosa chinensis] gb|PRQ20917.1| putative major facilitator, sugar transporter, major facilitator superfamily [Rosa chinensis] Length = 506 Score = 67.8 bits (164), Expect = 1e-10 Identities = 30/45 (66%), Positives = 36/45 (80%), Gaps = 2/45 (4%) Frame = -1 Query: 393 LLMSVFVYFLLPETKGIPIEKMDQIWGEHFFWKRFVS--HEDSKL 265 ++M+ FVYFLLPET IPIEKMD++WGEH+FWKR V ED KL Sbjct: 462 MVMTAFVYFLLPETTNIPIEKMDEVWGEHWFWKRIVGEVREDIKL 506 >ref|XP_021616936.1| hexose carrier protein HEX6 [Manihot esculenta] gb|OAY48120.1| hypothetical protein MANES_06G132700 [Manihot esculenta] Length = 508 Score = 67.8 bits (164), Expect = 1e-10 Identities = 30/48 (62%), Positives = 38/48 (79%), Gaps = 2/48 (4%) Frame = -1 Query: 393 LLMSVFVYFLLPETKGIPIEKMDQIWGEHFFWKRFVSH--EDSKLEAA 256 ++M+ FVYFLLPETK +PIEKMD +W EH+FWKR V +DSK+E A Sbjct: 461 VIMTAFVYFLLPETKNMPIEKMDIVWREHWFWKRIVGEAVDDSKMETA 508 >ref|XP_003566793.3| PREDICTED: sugar transport protein 1-like [Brachypodium distachyon] gb|PNT72210.1| hypothetical protein BRADI_2g41441v3 [Brachypodium distachyon] Length = 517 Score = 67.8 bits (164), Expect = 1e-10 Identities = 27/36 (75%), Positives = 34/36 (94%) Frame = -1 Query: 393 LLMSVFVYFLLPETKGIPIEKMDQIWGEHFFWKRFV 286 L+M++FVYF LPETKGIPIE+MD+IWG H++WKRFV Sbjct: 463 LVMTLFVYFFLPETKGIPIEEMDRIWGRHWYWKRFV 498 >ref|XP_024199315.1| sugar carrier protein C-like [Rosa chinensis] gb|PRQ35043.1| putative major facilitator, sugar transporter, major facilitator superfamily [Rosa chinensis] Length = 519 Score = 67.8 bits (164), Expect = 1e-10 Identities = 27/39 (69%), Positives = 35/39 (89%) Frame = -1 Query: 390 LMSVFVYFLLPETKGIPIEKMDQIWGEHFFWKRFVSHED 274 +MSVFVYF LPETKGIPIE+M ++W +H++WKRFV+ ED Sbjct: 464 VMSVFVYFFLPETKGIPIEEMSRVWKQHWYWKRFVTDED 502 >ref|XP_009374920.1| PREDICTED: sugar carrier protein C [Pyrus x bretschneideri] Length = 519 Score = 67.8 bits (164), Expect = 1e-10 Identities = 27/39 (69%), Positives = 34/39 (87%) Frame = -1 Query: 390 LMSVFVYFLLPETKGIPIEKMDQIWGEHFFWKRFVSHED 274 +MS+FVY+ LPETKGIPIE+M Q+W H++WKRFVS ED Sbjct: 465 VMSIFVYYFLPETKGIPIEEMGQVWRTHWYWKRFVSEED 503 >ref|XP_004293542.1| PREDICTED: sugar carrier protein C [Fragaria vesca subsp. vesca] Length = 519 Score = 67.8 bits (164), Expect = 1e-10 Identities = 27/39 (69%), Positives = 35/39 (89%) Frame = -1 Query: 390 LMSVFVYFLLPETKGIPIEKMDQIWGEHFFWKRFVSHED 274 +MSVFVYF LPETKGIPIE+M ++W +H++WKRFV+ ED Sbjct: 464 VMSVFVYFFLPETKGIPIEEMSRVWKQHWYWKRFVTDED 502 >gb|KVI10099.1| General substrate transporter [Cynara cardunculus var. scolymus] Length = 520 Score = 67.8 bits (164), Expect = 1e-10 Identities = 27/39 (69%), Positives = 34/39 (87%) Frame = -1 Query: 390 LMSVFVYFLLPETKGIPIEKMDQIWGEHFFWKRFVSHED 274 +M+VFVYF LPETK +PIEKMD+IW +H+FWKR+V ED Sbjct: 477 VMTVFVYFFLPETKNVPIEKMDRIWKQHWFWKRYVCEED 515 >gb|KMT00388.1| hypothetical protein BVRB_9g216930 [Beta vulgaris subsp. vulgaris] Length = 470 Score = 67.4 bits (163), Expect = 2e-10 Identities = 27/45 (60%), Positives = 35/45 (77%) Frame = -1 Query: 390 LMSVFVYFLLPETKGIPIEKMDQIWGEHFFWKRFVSHEDSKLEAA 256 LMSVF+YF LPETKG+PIE+M +W H+FW RF++H D L+ A Sbjct: 416 LMSVFIYFFLPETKGMPIEEMSIVWKNHWFWGRFITHNDDDLKMA 460 >gb|PON70922.1| Sugar/inositol transporter [Parasponia andersonii] Length = 517 Score = 67.4 bits (163), Expect = 2e-10 Identities = 27/40 (67%), Positives = 35/40 (87%) Frame = -1 Query: 393 LLMSVFVYFLLPETKGIPIEKMDQIWGEHFFWKRFVSHED 274 L+MS+FVYF LPETKGIPIE+M+QIW H++W RFV+ E+ Sbjct: 465 LIMSIFVYFFLPETKGIPIEEMNQIWRNHWYWSRFVTDEE 504 >ref|XP_024157209.1| sugar carrier protein C-like [Rosa chinensis] gb|PRQ28731.1| putative major facilitator, sugar transporter, major facilitator superfamily [Rosa chinensis] Length = 519 Score = 67.4 bits (163), Expect = 2e-10 Identities = 26/39 (66%), Positives = 35/39 (89%) Frame = -1 Query: 390 LMSVFVYFLLPETKGIPIEKMDQIWGEHFFWKRFVSHED 274 +MS+FVYF LPETKGIPIE+M ++W +H++WKRFV+ ED Sbjct: 464 VMSIFVYFFLPETKGIPIEEMSRVWKQHWYWKRFVTDED 502 >ref|XP_010691744.1| PREDICTED: sugar carrier protein C-like [Beta vulgaris subsp. vulgaris] Length = 519 Score = 67.4 bits (163), Expect = 2e-10 Identities = 27/45 (60%), Positives = 35/45 (77%) Frame = -1 Query: 390 LMSVFVYFLLPETKGIPIEKMDQIWGEHFFWKRFVSHEDSKLEAA 256 LMSVF+YF LPETKG+PIE+M +W H+FW RF++H D L+ A Sbjct: 465 LMSVFIYFFLPETKGMPIEEMSIVWKNHWFWGRFITHNDDDLKMA 509