BLASTX nr result
ID: Rehmannia31_contig00008408
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00008408 (419 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020548842.1| uncharacterized protein LOC105159634 isoform... 67 3e-10 ref|XP_011075052.2| uncharacterized protein LOC105159634 isoform... 67 3e-10 >ref|XP_020548842.1| uncharacterized protein LOC105159634 isoform X2 [Sesamum indicum] Length = 277 Score = 66.6 bits (161), Expect = 3e-10 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = -2 Query: 115 LEEMEKEERNIPRIMKAPVESEFLLQWGSRKRLRCVRV 2 L +MEKEER IPRI+K P E+EF LQWGSRKRLRCVRV Sbjct: 36 LADMEKEERTIPRILKPPAETEFFLQWGSRKRLRCVRV 73 >ref|XP_011075052.2| uncharacterized protein LOC105159634 isoform X1 [Sesamum indicum] Length = 314 Score = 66.6 bits (161), Expect = 3e-10 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = -2 Query: 115 LEEMEKEERNIPRIMKAPVESEFLLQWGSRKRLRCVRV 2 L +MEKEER IPRI+K P E+EF LQWGSRKRLRCVRV Sbjct: 73 LADMEKEERTIPRILKPPAETEFFLQWGSRKRLRCVRV 110