BLASTX nr result
ID: Rehmannia31_contig00008304
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00008304 (407 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011072081.1| RAP domain-containing protein, chloroplastic... 82 1e-15 >ref|XP_011072081.1| RAP domain-containing protein, chloroplastic [Sesamum indicum] Length = 678 Score = 82.4 bits (202), Expect = 1e-15 Identities = 39/61 (63%), Positives = 47/61 (77%) Frame = -2 Query: 253 MEASGFINSVATFHVPSTKAIIAFKTLLPIVNPKVHLRSLFQKHSCINPGNSYRRSGNLV 74 MEASG INSVATFH+PS KA FKT LP+V P++HL SL +KH CIN G +Y R+ N+V Sbjct: 1 MEASGLINSVATFHIPSAKAA-TFKTSLPVVGPRIHLNSLSRKHCCINSGKNYSRNDNIV 59 Query: 73 A 71 A Sbjct: 60 A 60