BLASTX nr result
ID: Rehmannia31_contig00008279
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00008279 (432 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN18033.1| hypothetical protein CDL12_09289 [Handroanthus im... 55 7e-06 >gb|PIN18033.1| hypothetical protein CDL12_09289 [Handroanthus impetiginosus] Length = 323 Score = 54.7 bits (130), Expect = 7e-06 Identities = 30/45 (66%), Positives = 32/45 (71%), Gaps = 4/45 (8%) Frame = +3 Query: 309 MAAMQNNCSEYSAVDDGQSSEVS----XXXXXXFMLFGVRVMMEG 431 MAA+ + CSEYSAVDDGQSSEVS FMLFGVRVM EG Sbjct: 1 MAAIHSKCSEYSAVDDGQSSEVSSGGGGGGGKGFMLFGVRVMTEG 45