BLASTX nr result
ID: Rehmannia31_contig00008207
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00008207 (363 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU35669.1| hypothetical protein MIMGU_mgv1a015417mg [Erythra... 66 4e-11 gb|EYU35668.1| hypothetical protein MIMGU_mgv1a015413mg [Erythra... 66 5e-11 >gb|EYU35669.1| hypothetical protein MIMGU_mgv1a015417mg [Erythranthe guttata] Length = 158 Score = 66.2 bits (160), Expect = 4e-11 Identities = 33/61 (54%), Positives = 38/61 (62%) Frame = +3 Query: 6 LGQATTNVNGSFNITVXXXXXXXXXXXXXXCVTTVQLPLNSVVCPVLSTTNGILASAIRS 185 LG TNVNGSFNITV CV TVQLPL+ VVCPVL+ T GILA+ + S Sbjct: 74 LGSGITNVNGSFNITVPAITGLILGLPMLPCVVTVQLPLSPVVCPVLNATTGILAATVNS 133 Query: 186 V 188 + Sbjct: 134 I 134 >gb|EYU35668.1| hypothetical protein MIMGU_mgv1a015413mg [Erythranthe guttata] Length = 158 Score = 65.9 bits (159), Expect = 5e-11 Identities = 33/61 (54%), Positives = 38/61 (62%) Frame = +3 Query: 6 LGQATTNVNGSFNITVXXXXXXXXXXXXXXCVTTVQLPLNSVVCPVLSTTNGILASAIRS 185 LG TNVNGSFNITV CV TVQLPL+ VVCPV++ T GILA+ + S Sbjct: 74 LGSGITNVNGSFNITVPAITGLILGLPMLPCVVTVQLPLSPVVCPVINATTGILAATVNS 133 Query: 186 V 188 V Sbjct: 134 V 134