BLASTX nr result
ID: Rehmannia31_contig00008117
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00008117 (457 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN08605.1| Non-specific serine/threonine protein kinase [Han... 68 1e-11 ref|XP_011069936.2| LOW QUALITY PROTEIN: uncharacterized protein... 63 1e-09 ref|XP_011079281.1| uncharacterized protein LOC105162833 isoform... 58 7e-08 ref|XP_012837578.1| PREDICTED: gibberellin-regulated protein 14-... 54 2e-06 ref|XP_012857275.1| PREDICTED: uncharacterized protein LOC105976... 53 7e-06 >gb|PIN08605.1| Non-specific serine/threonine protein kinase [Handroanthus impetiginosus] Length = 136 Score = 68.2 bits (165), Expect = 1e-11 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = +1 Query: 1 SRYQWALDDYYENNEKNQTEAKPQVKSSKIDNV 99 SRYQWALDDYYENNEKNQT+AKPQVK+SK++NV Sbjct: 104 SRYQWALDDYYENNEKNQTQAKPQVKASKLENV 136 >ref|XP_011069936.2| LOW QUALITY PROTEIN: uncharacterized protein LOC105155712 [Sesamum indicum] Length = 127 Score = 62.8 bits (151), Expect = 1e-09 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +1 Query: 1 SRYQWALDDYYENNEKNQTEAKPQVKSSKIDNV 99 S+YQWALDDYYE+N KNQTEAKPQVK SKI NV Sbjct: 95 SKYQWALDDYYESNGKNQTEAKPQVKPSKIQNV 127 >ref|XP_011079281.1| uncharacterized protein LOC105162833 isoform X1 [Sesamum indicum] ref|XP_011079282.1| uncharacterized protein LOC105162833 isoform X1 [Sesamum indicum] Length = 132 Score = 58.2 bits (139), Expect = 7e-08 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = +1 Query: 1 SRYQWALDDYYENNEKNQTEAKPQVKSSKIDNV 99 S+YQWALDDYYENN+KN TE K QVKSSK ++V Sbjct: 100 SKYQWALDDYYENNQKNPTETKTQVKSSKAESV 132 >ref|XP_012837578.1| PREDICTED: gibberellin-regulated protein 14-like [Erythranthe guttata] gb|EYU37309.1| hypothetical protein MIMGU_mgv1a015961mg [Erythranthe guttata] Length = 139 Score = 54.3 bits (129), Expect = 2e-06 Identities = 26/34 (76%), Positives = 29/34 (85%), Gaps = 1/34 (2%) Frame = +1 Query: 1 SRYQWALDDYYENNEKNQ-TEAKPQVKSSKIDNV 99 S+YQWALDDYYE+N KN EAKPQVKSSKI +V Sbjct: 106 SKYQWALDDYYESNGKNHVVEAKPQVKSSKIQSV 139 >ref|XP_012857275.1| PREDICTED: uncharacterized protein LOC105976581 [Erythranthe guttata] gb|EYU20896.1| hypothetical protein MIMGU_mgv1a016319mg [Erythranthe guttata] Length = 126 Score = 52.8 bits (125), Expect = 7e-06 Identities = 20/33 (60%), Positives = 28/33 (84%) Frame = +1 Query: 1 SRYQWALDDYYENNEKNQTEAKPQVKSSKIDNV 99 S+YQWALDDYY+NNEKN+ + KP++K K++ V Sbjct: 94 SKYQWALDDYYQNNEKNKRDDKPKIKEGKVEIV 126