BLASTX nr result
ID: Rehmannia31_contig00007816
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00007816 (435 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022876971.1| calcium-dependent protein kinase 21-like [Ol... 126 3e-34 ref|XP_011086186.1| calcium-dependent protein kinase [Sesamum in... 130 2e-32 ref|XP_011096067.1| calcium-dependent protein kinase [Sesamum in... 129 3e-32 ref|XP_022142200.1| calcium-dependent protein kinase 21-like [Mo... 127 1e-31 ref|XP_022879977.1| calcium-dependent protein kinase 2-like [Ole... 118 2e-31 ref|XP_012841982.1| PREDICTED: calcium-dependent protein kinase-... 126 3e-31 ref|XP_008439982.1| PREDICTED: calcium-dependent protein kinase ... 126 3e-31 ref|XP_004134759.1| PREDICTED: calcium-dependent protein kinase ... 126 3e-31 ref|XP_008345823.1| PREDICTED: calcium-dependent protein kinase ... 116 6e-31 ref|XP_022867973.1| calcium-dependent protein kinase 21-like [Ol... 122 6e-31 gb|PIN08573.1| Ca2+/calmodulin-dependent protein kinase, EF-Hand... 125 7e-31 ref|XP_022877975.1| calcium-dependent protein kinase-like isofor... 125 1e-30 ref|XP_022877974.1| calcium-dependent protein kinase-like isofor... 125 1e-30 ref|XP_023543712.1| calcium-dependent protein kinase 2-like [Cuc... 124 1e-30 ref|XP_022978862.1| calcium-dependent protein kinase 2-like [Cuc... 124 1e-30 ref|XP_022950188.1| calcium-dependent protein kinase 21-like [Cu... 124 1e-30 ref|XP_023002935.1| calcium-dependent protein kinase 21-like [Cu... 123 4e-30 ref|XP_023517514.1| calcium-dependent protein kinase 21-like [Cu... 123 4e-30 gb|EPS59225.1| calcium-dependent protein kinase 1, partial [Genl... 122 7e-30 gb|KHN38276.1| Calcium-dependent protein kinase 33 [Glycine soja] 120 7e-30 >ref|XP_022876971.1| calcium-dependent protein kinase 21-like [Olea europaea var. sylvestris] Length = 165 Score = 126 bits (317), Expect = 3e-34 Identities = 60/66 (90%), Positives = 63/66 (95%) Frame = -3 Query: 433 QFFDKDSSGYITRDELETAMKEYGMGDEATIKEIISEVDTDNDGKINYEEFCAMMRSGTT 254 Q+FDKD+SGYITRDELETAMKEYGMGDEATIKEIISEVDTDNDG+INYEEFC MMRSGTT Sbjct: 100 QYFDKDNSGYITRDELETAMKEYGMGDEATIKEIISEVDTDNDGRINYEEFCQMMRSGTT 159 Query: 253 QPLKLF 236 Q KLF Sbjct: 160 QQAKLF 165 >ref|XP_011086186.1| calcium-dependent protein kinase [Sesamum indicum] Length = 543 Score = 130 bits (326), Expect = 2e-32 Identities = 61/66 (92%), Positives = 65/66 (98%) Frame = -3 Query: 433 QFFDKDSSGYITRDELETAMKEYGMGDEATIKEIISEVDTDNDGKINYEEFCAMMRSGTT 254 Q+FDKDSSGYITRDELETAMKEYGMGDEATIKEIISEVDTDNDG+INY+EFCAMMRSGT Sbjct: 478 QYFDKDSSGYITRDELETAMKEYGMGDEATIKEIISEVDTDNDGRINYDEFCAMMRSGTQ 537 Query: 253 QPLKLF 236 QP+KLF Sbjct: 538 QPVKLF 543 >ref|XP_011096067.1| calcium-dependent protein kinase [Sesamum indicum] Length = 541 Score = 129 bits (324), Expect = 3e-32 Identities = 62/66 (93%), Positives = 64/66 (96%) Frame = -3 Query: 433 QFFDKDSSGYITRDELETAMKEYGMGDEATIKEIISEVDTDNDGKINYEEFCAMMRSGTT 254 QFFDKDSSGYITRDELETAMKEYGMGDEATIKEIISEVDTDNDG+INYEEFCAMMRSGT Sbjct: 476 QFFDKDSSGYITRDELETAMKEYGMGDEATIKEIISEVDTDNDGRINYEEFCAMMRSGTQ 535 Query: 253 QPLKLF 236 Q +KLF Sbjct: 536 QQVKLF 541 >ref|XP_022142200.1| calcium-dependent protein kinase 21-like [Momordica charantia] Length = 556 Score = 127 bits (320), Expect = 1e-31 Identities = 60/66 (90%), Positives = 65/66 (98%) Frame = -3 Query: 433 QFFDKDSSGYITRDELETAMKEYGMGDEATIKEIISEVDTDNDGKINYEEFCAMMRSGTT 254 QFFDKDSSGYIT+DELETAMK+YGMGDEA+IKEIISEVDTDNDG+INY+EFCAMMRSGTT Sbjct: 491 QFFDKDSSGYITKDELETAMKDYGMGDEASIKEIISEVDTDNDGRINYQEFCAMMRSGTT 550 Query: 253 QPLKLF 236 QP KLF Sbjct: 551 QPGKLF 556 >ref|XP_022879977.1| calcium-dependent protein kinase 2-like [Olea europaea var. sylvestris] Length = 125 Score = 118 bits (295), Expect = 2e-31 Identities = 54/66 (81%), Positives = 62/66 (93%) Frame = -3 Query: 433 QFFDKDSSGYITRDELETAMKEYGMGDEATIKEIISEVDTDNDGKINYEEFCAMMRSGTT 254 Q+FDKD+SG+ITRDELETAMKEYGMGD ATIKEI+SEVD+DNDG+INYEEFC MMR+GT Sbjct: 60 QYFDKDNSGFITRDELETAMKEYGMGDPATIKEILSEVDSDNDGRINYEEFCTMMRTGTQ 119 Query: 253 QPLKLF 236 QP +LF Sbjct: 120 QPDRLF 125 >ref|XP_012841982.1| PREDICTED: calcium-dependent protein kinase-like [Erythranthe guttata] gb|EYU33891.1| hypothetical protein MIMGU_mgv1a004201mg [Erythranthe guttata] Length = 539 Score = 126 bits (317), Expect = 3e-31 Identities = 62/67 (92%), Positives = 66/67 (98%), Gaps = 1/67 (1%) Frame = -3 Query: 433 QFFDKDSSGYITRDELETAMKEYGMGDEATIKEIISEVDTDNDGKINYEEFCAMMRSGTT 254 QFFDKDSSGYITRDEL++AMKEYGMGDEATI+EIISEVDTDNDGKINYEEFCAMMRSGTT Sbjct: 473 QFFDKDSSGYITRDELKSAMKEYGMGDEATIEEIISEVDTDNDGKINYEEFCAMMRSGTT 532 Query: 253 QP-LKLF 236 QP +KLF Sbjct: 533 QPAVKLF 539 >ref|XP_008439982.1| PREDICTED: calcium-dependent protein kinase 2 [Cucumis melo] Length = 552 Score = 126 bits (317), Expect = 3e-31 Identities = 59/66 (89%), Positives = 65/66 (98%) Frame = -3 Query: 433 QFFDKDSSGYITRDELETAMKEYGMGDEATIKEIISEVDTDNDGKINYEEFCAMMRSGTT 254 QFFDKDSSGYIT+DELETAMK+YGMGDEA+I+EIISEVDTDNDG+INY+EFCAMMRSGTT Sbjct: 487 QFFDKDSSGYITKDELETAMKDYGMGDEASIREIISEVDTDNDGRINYQEFCAMMRSGTT 546 Query: 253 QPLKLF 236 QP KLF Sbjct: 547 QPGKLF 552 >ref|XP_004134759.1| PREDICTED: calcium-dependent protein kinase 2-like [Cucumis sativus] gb|KGN49114.1| hypothetical protein Csa_6G513780 [Cucumis sativus] Length = 552 Score = 126 bits (317), Expect = 3e-31 Identities = 59/66 (89%), Positives = 65/66 (98%) Frame = -3 Query: 433 QFFDKDSSGYITRDELETAMKEYGMGDEATIKEIISEVDTDNDGKINYEEFCAMMRSGTT 254 QFFDKDSSGYIT+DELETAMK+YGMGDEA+I+EIISEVDTDNDG+INY+EFCAMMRSGTT Sbjct: 487 QFFDKDSSGYITKDELETAMKDYGMGDEASIREIISEVDTDNDGRINYQEFCAMMRSGTT 546 Query: 253 QPLKLF 236 QP KLF Sbjct: 547 QPGKLF 552 >ref|XP_008345823.1| PREDICTED: calcium-dependent protein kinase 2-like [Malus domestica] Length = 103 Score = 116 bits (290), Expect = 6e-31 Identities = 54/66 (81%), Positives = 59/66 (89%) Frame = -3 Query: 433 QFFDKDSSGYITRDELETAMKEYGMGDEATIKEIISEVDTDNDGKINYEEFCAMMRSGTT 254 Q+FDKDSSGYITRDELE AMKE+GMGD+ TI+EIISEVD DNDG+INY EFCAMMRSG Sbjct: 38 QYFDKDSSGYITRDELEAAMKEHGMGDDNTIREIISEVDADNDGRINYSEFCAMMRSGAQ 97 Query: 253 QPLKLF 236 QP KLF Sbjct: 98 QPAKLF 103 >ref|XP_022867973.1| calcium-dependent protein kinase 21-like [Olea europaea var. sylvestris] Length = 305 Score = 122 bits (305), Expect = 6e-31 Identities = 57/66 (86%), Positives = 62/66 (93%) Frame = -3 Query: 433 QFFDKDSSGYITRDELETAMKEYGMGDEATIKEIISEVDTDNDGKINYEEFCAMMRSGTT 254 Q+FDKD+SG+ITRDELE AMKEYGMGDEATI+EIISEVDTDNDG+INYEEFC MMRSGTT Sbjct: 240 QYFDKDNSGFITRDELENAMKEYGMGDEATIREIISEVDTDNDGRINYEEFCEMMRSGTT 299 Query: 253 QPLKLF 236 Q KLF Sbjct: 300 QQAKLF 305 >gb|PIN08573.1| Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Handroanthus impetiginosus] Length = 536 Score = 125 bits (314), Expect = 7e-31 Identities = 59/66 (89%), Positives = 63/66 (95%) Frame = -3 Query: 433 QFFDKDSSGYITRDELETAMKEYGMGDEATIKEIISEVDTDNDGKINYEEFCAMMRSGTT 254 Q+FDKD SGYIT DELETAMKEYGMGDEATIKEIISEVDTDNDG+INY+EFCAMMRSGTT Sbjct: 471 QYFDKDGSGYITMDELETAMKEYGMGDEATIKEIISEVDTDNDGRINYDEFCAMMRSGTT 530 Query: 253 QPLKLF 236 Q +KLF Sbjct: 531 QQVKLF 536 >ref|XP_022877975.1| calcium-dependent protein kinase-like isoform X2 [Olea europaea var. sylvestris] Length = 554 Score = 125 bits (313), Expect = 1e-30 Identities = 59/66 (89%), Positives = 62/66 (93%) Frame = -3 Query: 433 QFFDKDSSGYITRDELETAMKEYGMGDEATIKEIISEVDTDNDGKINYEEFCAMMRSGTT 254 Q+FDKD+SGYITRDELETAMKEYGMGDE TIKEIISEVDTDNDG+INYEEFC MMRSGTT Sbjct: 489 QYFDKDNSGYITRDELETAMKEYGMGDETTIKEIISEVDTDNDGRINYEEFCQMMRSGTT 548 Query: 253 QPLKLF 236 Q KLF Sbjct: 549 QQAKLF 554 >ref|XP_022877974.1| calcium-dependent protein kinase-like isoform X1 [Olea europaea var. sylvestris] Length = 559 Score = 125 bits (313), Expect = 1e-30 Identities = 59/66 (89%), Positives = 62/66 (93%) Frame = -3 Query: 433 QFFDKDSSGYITRDELETAMKEYGMGDEATIKEIISEVDTDNDGKINYEEFCAMMRSGTT 254 Q+FDKD+SGYITRDELETAMKEYGMGDE TIKEIISEVDTDNDG+INYEEFC MMRSGTT Sbjct: 494 QYFDKDNSGYITRDELETAMKEYGMGDETTIKEIISEVDTDNDGRINYEEFCQMMRSGTT 553 Query: 253 QPLKLF 236 Q KLF Sbjct: 554 QQAKLF 559 >ref|XP_023543712.1| calcium-dependent protein kinase 2-like [Cucurbita pepo subsp. pepo] Length = 551 Score = 124 bits (312), Expect = 1e-30 Identities = 58/66 (87%), Positives = 64/66 (96%) Frame = -3 Query: 433 QFFDKDSSGYITRDELETAMKEYGMGDEATIKEIISEVDTDNDGKINYEEFCAMMRSGTT 254 QFFDKDSSGYIT+DELE AMK+YGMGDEA+I+EIISEVDTDNDG+INY+EFCAMMRSGTT Sbjct: 486 QFFDKDSSGYITKDELEAAMKDYGMGDEASIREIISEVDTDNDGRINYQEFCAMMRSGTT 545 Query: 253 QPLKLF 236 QP KLF Sbjct: 546 QPGKLF 551 >ref|XP_022978862.1| calcium-dependent protein kinase 2-like [Cucurbita maxima] Length = 551 Score = 124 bits (312), Expect = 1e-30 Identities = 58/66 (87%), Positives = 64/66 (96%) Frame = -3 Query: 433 QFFDKDSSGYITRDELETAMKEYGMGDEATIKEIISEVDTDNDGKINYEEFCAMMRSGTT 254 QFFDKDSSGYIT+DELE AMK+YGMGDEA+I+EIISEVDTDNDG+INY+EFCAMMRSGTT Sbjct: 486 QFFDKDSSGYITKDELEAAMKDYGMGDEASIREIISEVDTDNDGRINYQEFCAMMRSGTT 545 Query: 253 QPLKLF 236 QP KLF Sbjct: 546 QPGKLF 551 >ref|XP_022950188.1| calcium-dependent protein kinase 21-like [Cucurbita moschata] Length = 551 Score = 124 bits (312), Expect = 1e-30 Identities = 58/66 (87%), Positives = 64/66 (96%) Frame = -3 Query: 433 QFFDKDSSGYITRDELETAMKEYGMGDEATIKEIISEVDTDNDGKINYEEFCAMMRSGTT 254 QFFDKDSSGYIT+DELE AMK+YGMGDEA+I+EIISEVDTDNDG+INY+EFCAMMRSGTT Sbjct: 486 QFFDKDSSGYITKDELEAAMKDYGMGDEASIREIISEVDTDNDGRINYQEFCAMMRSGTT 545 Query: 253 QPLKLF 236 QP KLF Sbjct: 546 QPGKLF 551 >ref|XP_023002935.1| calcium-dependent protein kinase 21-like [Cucurbita maxima] Length = 549 Score = 123 bits (309), Expect = 4e-30 Identities = 58/66 (87%), Positives = 63/66 (95%) Frame = -3 Query: 433 QFFDKDSSGYITRDELETAMKEYGMGDEATIKEIISEVDTDNDGKINYEEFCAMMRSGTT 254 QFFD DSSGYIT+DELE AMK+YGMGDEA+IKEIISEVDTDNDG+INY+EFCAMMRSGTT Sbjct: 484 QFFDMDSSGYITKDELENAMKDYGMGDEASIKEIISEVDTDNDGRINYQEFCAMMRSGTT 543 Query: 253 QPLKLF 236 QP KLF Sbjct: 544 QPGKLF 549 >ref|XP_023517514.1| calcium-dependent protein kinase 21-like [Cucurbita pepo subsp. pepo] Length = 550 Score = 123 bits (309), Expect = 4e-30 Identities = 58/66 (87%), Positives = 63/66 (95%) Frame = -3 Query: 433 QFFDKDSSGYITRDELETAMKEYGMGDEATIKEIISEVDTDNDGKINYEEFCAMMRSGTT 254 QFFD DSSGYIT+DELE AMK+YGMGDEA+IKEIISEVDTDNDG+INY+EFCAMMRSGTT Sbjct: 485 QFFDMDSSGYITKDELENAMKDYGMGDEASIKEIISEVDTDNDGRINYQEFCAMMRSGTT 544 Query: 253 QPLKLF 236 QP KLF Sbjct: 545 QPGKLF 550 >gb|EPS59225.1| calcium-dependent protein kinase 1, partial [Genlisea aurea] Length = 503 Score = 122 bits (306), Expect = 7e-30 Identities = 59/67 (88%), Positives = 64/67 (95%), Gaps = 1/67 (1%) Frame = -3 Query: 433 QFFDKDSSGYITRDELETAMKEYGMGDEATIKEIISEVDTDNDGKINYEEFCAMMRSGTT 254 QFFD D+SGYITRDELETAMK+YGMGDEATI+EIISEVDTDNDG+INYEEFC MMRSGTT Sbjct: 437 QFFDTDNSGYITRDELETAMKKYGMGDEATIREIISEVDTDNDGRINYEEFCTMMRSGTT 496 Query: 253 -QPLKLF 236 QP+KLF Sbjct: 497 QQPVKLF 503 >gb|KHN38276.1| Calcium-dependent protein kinase 33 [Glycine soja] Length = 391 Score = 120 bits (302), Expect = 7e-30 Identities = 57/66 (86%), Positives = 61/66 (92%) Frame = -3 Query: 433 QFFDKDSSGYITRDELETAMKEYGMGDEATIKEIISEVDTDNDGKINYEEFCAMMRSGTT 254 Q+FDKD SGYITRDELETAMKEYGMGDEATI+EIISEVDTDNDG+INY+EFC MMRSGT Sbjct: 326 QYFDKDGSGYITRDELETAMKEYGMGDEATIREIISEVDTDNDGRINYDEFCTMMRSGTQ 385 Query: 253 QPLKLF 236 Q KLF Sbjct: 386 QQGKLF 391