BLASTX nr result
ID: Rehmannia31_contig00007364
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00007364 (429 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011075427.1| uncharacterized protein LOC105159908 [Sesamu... 57 3e-08 ref|XP_012828036.1| PREDICTED: uncharacterized protein LOC105949... 56 8e-08 gb|PIN10205.1| hypothetical protein CDL12_17212 [Handroanthus im... 54 7e-07 gb|EXB54302.1| hypothetical protein L484_003441 [Morus notabilis] 52 2e-06 ref|XP_010093580.2| uncharacterized protein LOC21386978 [Morus n... 52 2e-06 >ref|XP_011075427.1| uncharacterized protein LOC105159908 [Sesamum indicum] ref|XP_011075428.1| uncharacterized protein LOC105159908 [Sesamum indicum] ref|XP_020548809.1| uncharacterized protein LOC105159908 [Sesamum indicum] Length = 60 Score = 57.0 bits (136), Expect = 3e-08 Identities = 28/44 (63%), Positives = 30/44 (68%) Frame = +3 Query: 3 VNAVLVSTIGPVYDFVCFLPYWXXXXXXXXXXXXAASTKVFGSS 134 +NAVL+STI PVYDFVCFLPYW AASTK FGSS Sbjct: 17 LNAVLMSTITPVYDFVCFLPYWERRRERRRQEREAASTKGFGSS 60 >ref|XP_012828036.1| PREDICTED: uncharacterized protein LOC105949295 [Erythranthe guttata] gb|EYU18626.1| hypothetical protein MIMGU_mgv1a025124mg [Erythranthe guttata] Length = 60 Score = 55.8 bits (133), Expect = 8e-08 Identities = 28/44 (63%), Positives = 29/44 (65%) Frame = +3 Query: 3 VNAVLVSTIGPVYDFVCFLPYWXXXXXXXXXXXXAASTKVFGSS 134 +NAVLVSTI PVYDFVCFLPYW AASTK F SS Sbjct: 17 LNAVLVSTITPVYDFVCFLPYWERRRERLRKEREAASTKDFASS 60 >gb|PIN10205.1| hypothetical protein CDL12_17212 [Handroanthus impetiginosus] gb|PIN21498.1| hypothetical protein CDL12_05802 [Handroanthus impetiginosus] Length = 62 Score = 53.5 bits (127), Expect = 7e-07 Identities = 29/46 (63%), Positives = 30/46 (65%), Gaps = 2/46 (4%) Frame = +3 Query: 3 VNAVLVSTIGPVYDFVCFLPYWXXXXXXXXXXXXA--ASTKVFGSS 134 +NAVLVSTI PVYDFVCFLPYW A ASTK FGSS Sbjct: 17 LNAVLVSTITPVYDFVCFLPYWERRRERRRKEREAETASTKSFGSS 62 >gb|EXB54302.1| hypothetical protein L484_003441 [Morus notabilis] Length = 53 Score = 52.0 bits (123), Expect = 2e-06 Identities = 22/22 (100%), Positives = 22/22 (100%) Frame = +3 Query: 3 VNAVLVSTIGPVYDFVCFLPYW 68 VNAVLVSTIGPVYDFVCFLPYW Sbjct: 10 VNAVLVSTIGPVYDFVCFLPYW 31 >ref|XP_010093580.2| uncharacterized protein LOC21386978 [Morus notabilis] ref|XP_024019568.1| uncharacterized protein LOC21386978 [Morus notabilis] Length = 60 Score = 52.0 bits (123), Expect = 2e-06 Identities = 22/22 (100%), Positives = 22/22 (100%) Frame = +3 Query: 3 VNAVLVSTIGPVYDFVCFLPYW 68 VNAVLVSTIGPVYDFVCFLPYW Sbjct: 17 VNAVLVSTIGPVYDFVCFLPYW 38