BLASTX nr result
ID: Rehmannia31_contig00007344
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00007344 (462 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011092444.2| transcription factor bHLH143 isoform X2 [Ses... 59 3e-07 ref|XP_020552776.1| transcription factor bHLH143 isoform X1 [Ses... 59 3e-07 >ref|XP_011092444.2| transcription factor bHLH143 isoform X2 [Sesamum indicum] Length = 366 Score = 58.9 bits (141), Expect = 3e-07 Identities = 34/46 (73%), Positives = 35/46 (76%) Frame = -1 Query: 462 SIIPDELPSTDPLSIIDKAIVYLKSMKIEAEALGLSYLGGKSLALP 325 SIIP L S DPLSIIDKAI YLKSMK EAEALGLSY + ALP Sbjct: 322 SIIPG-LTSNDPLSIIDKAITYLKSMKTEAEALGLSYPKSEPSALP 366 >ref|XP_020552776.1| transcription factor bHLH143 isoform X1 [Sesamum indicum] ref|XP_020552777.1| transcription factor bHLH143 isoform X1 [Sesamum indicum] ref|XP_020552778.1| transcription factor bHLH143 isoform X1 [Sesamum indicum] Length = 381 Score = 58.9 bits (141), Expect = 3e-07 Identities = 34/46 (73%), Positives = 35/46 (76%) Frame = -1 Query: 462 SIIPDELPSTDPLSIIDKAIVYLKSMKIEAEALGLSYLGGKSLALP 325 SIIP L S DPLSIIDKAI YLKSMK EAEALGLSY + ALP Sbjct: 337 SIIPG-LTSNDPLSIIDKAITYLKSMKTEAEALGLSYPKSEPSALP 381