BLASTX nr result
ID: Rehmannia31_contig00007192
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00007192 (426 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011083468.1| pyruvate dehydrogenase E1 component subunit ... 59 3e-07 ref|XP_011083473.1| pyruvate dehydrogenase E1 component subunit ... 57 8e-07 >ref|XP_011083468.1| pyruvate dehydrogenase E1 component subunit beta-1, mitochondrial-like isoform X1 [Sesamum indicum] Length = 379 Score = 58.5 bits (140), Expect = 3e-07 Identities = 27/41 (65%), Positives = 34/41 (82%) Frame = -2 Query: 125 KKATKMWGIIRQRAACKGNHALNLEQGIRAIALRAFSSSAK 3 ++ +M+G IRQRAAC+GNHA +LE+GIRA ALR FSSS K Sbjct: 10 REEKRMFGFIRQRAACRGNHASSLERGIRATALRTFSSSGK 50 >ref|XP_011083473.1| pyruvate dehydrogenase E1 component subunit beta-1, mitochondrial-like isoform X2 [Sesamum indicum] ref|XP_011083475.1| pyruvate dehydrogenase E1 component subunit beta-1, mitochondrial-like isoform X2 [Sesamum indicum] Length = 365 Score = 57.4 bits (137), Expect = 8e-07 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = -2 Query: 110 MWGIIRQRAACKGNHALNLEQGIRAIALRAFSSSAK 3 M+G IRQRAAC+GNHA +LE+GIRA ALR FSSS K Sbjct: 1 MFGFIRQRAACRGNHASSLERGIRATALRTFSSSGK 36