BLASTX nr result
ID: Rehmannia31_contig00005982
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00005982 (538 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN00582.1| Serine/threonine protein kinase [Handroanthus imp... 59 8e-07 >gb|PIN00582.1| Serine/threonine protein kinase [Handroanthus impetiginosus] gb|PIN15702.1| Serine/threonine protein kinase [Handroanthus impetiginosus] Length = 413 Score = 58.5 bits (140), Expect = 8e-07 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = +3 Query: 435 FSAASGSDEGTPNPAGQMLPHPNLRVFSFSELKA 536 FSAASGSDE + +P G MLPHPNLR+FSFSELKA Sbjct: 46 FSAASGSDEASLSPTGLMLPHPNLRIFSFSELKA 79