BLASTX nr result
ID: Rehmannia31_contig00005315
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00005315 (385 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_015869643.1| PREDICTED: mitogen-activated protein kinase ... 55 9e-07 ref|XP_009609626.1| PREDICTED: mitogen-activated protein kinase ... 54 2e-06 ref|XP_010660941.1| PREDICTED: mitogen-activated protein kinase ... 54 4e-06 gb|EYU23444.1| hypothetical protein MIMGU_mgv1a006112mg [Erythra... 54 7e-06 ref|XP_020210323.1| mitogen-activated protein kinase kinase kina... 52 7e-06 >ref|XP_015869643.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like [Ziziphus jujuba] Length = 140 Score = 54.7 bits (130), Expect = 9e-07 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = +2 Query: 2 KGANILVDPNGRVKLADFGMAKHVRVACS 88 KGANILVDPNGRVKLADFGMAKHVR S Sbjct: 103 KGANILVDPNGRVKLADFGMAKHVRFTFS 131 >ref|XP_009609626.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA-like [Nicotiana tomentosiformis] Length = 132 Score = 53.5 bits (127), Expect = 2e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = +2 Query: 2 KGANILVDPNGRVKLADFGMAKHVRVACSF 91 KGANILVDPNGR+KLADFGMAKHV + F Sbjct: 103 KGANILVDPNGRIKLADFGMAKHVSLPIDF 132 >ref|XP_010660941.1| PREDICTED: mitogen-activated protein kinase kinase kinase YODA [Vitis vinifera] emb|CBI34700.3| unnamed protein product, partial [Vitis vinifera] Length = 244 Score = 54.3 bits (129), Expect = 4e-06 Identities = 27/31 (87%), Positives = 27/31 (87%), Gaps = 1/31 (3%) Frame = +2 Query: 2 KGANILVDPNGRVKLADFGMAKHVRV-ACSF 91 KGANILVDPNG VKLADFGMAKHVRV C F Sbjct: 213 KGANILVDPNGHVKLADFGMAKHVRVFTCIF 243 >gb|EYU23444.1| hypothetical protein MIMGU_mgv1a006112mg [Erythranthe guttata] Length = 457 Score = 54.3 bits (129), Expect = 7e-06 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +2 Query: 2 KGANILVDPNGRVKLADFGMAKHVR 76 KGANILVDPNGRVKLADFGMAKHVR Sbjct: 430 KGANILVDPNGRVKLADFGMAKHVR 454 >ref|XP_020210323.1| mitogen-activated protein kinase kinase kinase YODA-like [Cajanus cajan] Length = 142 Score = 52.4 bits (124), Expect = 7e-06 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +2 Query: 2 KGANILVDPNGRVKLADFGMAKHV 73 KGANILVDPNGRVKLADFGMAKHV Sbjct: 103 KGANILVDPNGRVKLADFGMAKHV 126