BLASTX nr result
ID: Rehmannia31_contig00004743
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00004743 (926 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KZV58502.1| hypothetical protein F511_23755 [Dorcoceras hygro... 47 2e-06 >gb|KZV58502.1| hypothetical protein F511_23755 [Dorcoceras hygrometricum] Length = 184 Score = 47.0 bits (110), Expect(2) = 2e-06 Identities = 19/40 (47%), Positives = 30/40 (75%) Frame = +2 Query: 314 RLSCTVWENYVEQILPHLENNIIDPVVVILQMGRTKVFKG 433 +LSCT+W ++V I+ HLE + +P ++ILQM R+K F+G Sbjct: 62 KLSCTLWGDFVNDIMSHLEKSGNNPAIIILQMCRSKQFRG 101 Score = 33.9 bits (76), Expect(2) = 2e-06 Identities = 13/29 (44%), Positives = 21/29 (72%) Frame = +3 Query: 519 QVKMPNNFYVTKLIVNEAIDEIEDFKRRL 605 ++++ N FYVTK+IV E+ EI F+ R+ Sbjct: 102 EIRVSNTFYVTKMIVKESFGEIMQFRERV 130