BLASTX nr result
ID: Rehmannia31_contig00004608
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00004608 (997 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAP69815.1| chlorophyll a/b-binding protein, partial [Vitis v... 79 7e-15 gb|ALX37541.1| chlorophyll a /b binding protein, partial [Beta n... 81 8e-15 gb|ALX37542.1| chlorophyll a /b binding protein, partial [Beta m... 81 1e-14 gb|ALX37543.1| chlorophyll a /b binding protein, partial [Beta l... 81 1e-14 gb|ALX37556.1| chlorophyll a /b binding protein, partial [Beta v... 81 1e-14 gb|ALX37547.1| chlorophyll a /b binding protein, partial [Beta v... 81 1e-14 gb|ALX37544.1| chlorophyll a /b binding protein, partial [Beta v... 81 1e-14 ref|XP_006374459.1| hypothetical protein POPTR_0015s07340g [Popu... 80 1e-14 gb|AEX12937.1| hypothetical protein CL1595Contig1_02, partial [P... 77 1e-14 gb|KHL91182.1| hypothetical protein QW71_36155 [Paenibacillus sp... 81 2e-14 gb|AAG40364.1|AF325012_1 AT3g47470 [Arabidopsis thaliana] 79 3e-14 ref|XP_002514741.1| PREDICTED: chlorophyll a-b binding protein P... 82 3e-14 ref|XP_015883459.1| PREDICTED: chlorophyll a-b binding protein P... 82 3e-14 gb|EYU24361.1| hypothetical protein MIMGU_mgv1a012416mg [Erythra... 80 3e-14 gb|PNT00702.1| hypothetical protein POPTR_015G062200v3 [Populus ... 79 4e-14 ref|WP_083442875.1| hypothetical protein [Paenibacillus sp. IHB ... 81 4e-14 ref|XP_020586734.1| chlorophyll a-b binding protein 4, chloropla... 81 5e-14 gb|ABX71549.1| chloroplast chlorophyll a/b binding protein, part... 78 5e-14 ref|XP_009804068.1| PREDICTED: chlorophyll a-b binding protein 4... 81 6e-14 ref|XP_020277049.1| chlorophyll a-b binding protein 4, chloropla... 81 6e-14 >gb|AAP69815.1| chlorophyll a/b-binding protein, partial [Vitis vinifera] Length = 96 Score = 79.3 bits (194), Expect = 7e-15 Identities = 33/39 (84%), Positives = 37/39 (94%) Frame = -2 Query: 996 AFLGFVIQHNVTGKGPFDNLLQHLSDPWHNTIIQTFK*F 880 AFLGF++QHNVTGKGPFDNLLQH+SDPWHNTIIQT + F Sbjct: 58 AFLGFIVQHNVTGKGPFDNLLQHISDPWHNTIIQTLRGF 96 >gb|ALX37541.1| chlorophyll a /b binding protein, partial [Beta nana] Length = 148 Score = 80.9 bits (198), Expect = 8e-15 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = -2 Query: 996 AFLGFVIQHNVTGKGPFDNLLQHLSDPWHNTIIQTF 889 AFLGF++QHNVTGKGPFDNLLQHLSDPWHNTIIQTF Sbjct: 110 AFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIIQTF 145 >gb|ALX37542.1| chlorophyll a /b binding protein, partial [Beta macrorhiza] Length = 158 Score = 80.9 bits (198), Expect = 1e-14 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = -2 Query: 996 AFLGFVIQHNVTGKGPFDNLLQHLSDPWHNTIIQTF 889 AFLGF++QHNVTGKGPFDNLLQHLSDPWHNTIIQTF Sbjct: 120 AFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIIQTF 155 >gb|ALX37543.1| chlorophyll a /b binding protein, partial [Beta lomatogona] Length = 159 Score = 80.9 bits (198), Expect = 1e-14 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = -2 Query: 996 AFLGFVIQHNVTGKGPFDNLLQHLSDPWHNTIIQTF 889 AFLGF++QHNVTGKGPFDNLLQHLSDPWHNTIIQTF Sbjct: 121 AFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIIQTF 156 >gb|ALX37556.1| chlorophyll a /b binding protein, partial [Beta vulgaris subsp. maritima] gb|ALX37558.1| chlorophyll a /b binding protein, partial [Beta vulgaris subsp. maritima] gb|ALX37594.1| chlorophyll a /b binding protein, partial [Beta macrocarpa] gb|ALX37595.1| chlorophyll a /b binding protein, partial [Beta macrocarpa] Length = 163 Score = 80.9 bits (198), Expect = 1e-14 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = -2 Query: 996 AFLGFVIQHNVTGKGPFDNLLQHLSDPWHNTIIQTF 889 AFLGF++QHNVTGKGPFDNLLQHLSDPWHNTIIQTF Sbjct: 125 AFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIIQTF 160 >gb|ALX37547.1| chlorophyll a /b binding protein, partial [Beta vulgaris subsp. maritima] Length = 163 Score = 80.9 bits (198), Expect = 1e-14 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = -2 Query: 996 AFLGFVIQHNVTGKGPFDNLLQHLSDPWHNTIIQTF 889 AFLGF++QHNVTGKGPFDNLLQHLSDPWHNTIIQTF Sbjct: 125 AFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIIQTF 160 >gb|ALX37544.1| chlorophyll a /b binding protein, partial [Beta vulgaris subsp. maritima] gb|ALX37545.1| chlorophyll a /b binding protein, partial [Beta vulgaris subsp. maritima] gb|ALX37546.1| chlorophyll a /b binding protein, partial [Beta vulgaris subsp. maritima] gb|ALX37548.1| chlorophyll a /b binding protein, partial [Beta vulgaris subsp. maritima] gb|ALX37549.1| chlorophyll a /b binding protein, partial [Beta vulgaris subsp. maritima] gb|ALX37550.1| chlorophyll a /b binding protein, partial [Beta vulgaris subsp. maritima] gb|ALX37551.1| chlorophyll a /b binding protein, partial [Beta vulgaris subsp. maritima] gb|ALX37552.1| chlorophyll a /b binding protein, partial [Beta vulgaris subsp. maritima] gb|ALX37553.1| chlorophyll a /b binding protein, partial [Beta vulgaris subsp. maritima] gb|ALX37554.1| chlorophyll a /b binding protein, partial [Beta vulgaris subsp. maritima] gb|ALX37555.1| chlorophyll a /b binding protein, partial [Beta vulgaris subsp. maritima] gb|ALX37557.1| chlorophyll a /b binding protein, partial [Beta vulgaris subsp. maritima] gb|ALX37559.1| chlorophyll a /b binding protein, partial [Beta vulgaris subsp. maritima] gb|ALX37560.1| chlorophyll a /b binding protein, partial [Beta vulgaris subsp. maritima] gb|ALX37561.1| chlorophyll a /b binding protein, partial [Beta vulgaris subsp. maritima] gb|ALX37562.1| chlorophyll a /b binding protein, partial [Beta vulgaris subsp. maritima] gb|ALX37563.1| chlorophyll a /b binding protein, partial [Beta vulgaris subsp. maritima] gb|ALX37564.1| chlorophyll a /b binding protein, partial [Beta vulgaris subsp. maritima] gb|ALX37565.1| chlorophyll a /b binding protein, partial [Beta vulgaris subsp. maritima] gb|ALX37566.1| chlorophyll a /b binding protein, partial [Beta vulgaris subsp. maritima] gb|ALX37567.1| chlorophyll a /b binding protein, partial [Beta vulgaris subsp. maritima] gb|ALX37568.1| chlorophyll a /b binding protein, partial [Beta vulgaris subsp. maritima] gb|ALX37569.1| chlorophyll a /b binding protein, partial [Beta vulgaris subsp. maritima] gb|ALX37570.1| chlorophyll a /b binding protein, partial [Beta vulgaris subsp. maritima] gb|ALX37571.1| chlorophyll a /b binding protein, partial [Beta vulgaris subsp. maritima] gb|ALX37572.1| chlorophyll a /b binding protein, partial [Beta vulgaris subsp. maritima] gb|ALX37573.1| chlorophyll a /b binding protein, partial [Beta vulgaris subsp. maritima] gb|ALX37574.1| chlorophyll a /b binding protein, partial [Beta vulgaris subsp. maritima] gb|ALX37575.1| chlorophyll a /b binding protein, partial [Beta vulgaris subsp. maritima] gb|ALX37576.1| chlorophyll a /b binding protein, partial [Beta vulgaris subsp. adanensis] gb|ALX37577.1| chlorophyll a /b binding protein, partial [Beta vulgaris subsp. adanensis] gb|ALX37578.1| chlorophyll a /b binding protein, partial [Beta vulgaris subsp. adanensis] gb|ALX37579.1| chlorophyll a /b binding protein, partial [Beta vulgaris subsp. adanensis] gb|ALX37580.1| chlorophyll a /b binding protein, partial [Beta vulgaris subsp. adanensis] gb|ALX37581.1| chlorophyll a /b binding protein, partial [Beta vulgaris subsp. adanensis] gb|ALX37582.1| chlorophyll a /b binding protein, partial [Beta vulgaris subsp. adanensis] gb|ALX37583.1| chlorophyll a /b binding protein, partial [Beta vulgaris subsp. adanensis] gb|ALX37584.1| chlorophyll a /b binding protein, partial [Beta vulgaris subsp. adanensis] gb|ALX37585.1| chlorophyll a /b binding protein, partial [Beta vulgaris subsp. adanensis] gb|ALX37586.1| chlorophyll a /b binding protein, partial [Beta vulgaris subsp. adanensis] gb|ALX37587.1| chlorophyll a /b binding protein, partial [Beta macrocarpa] gb|ALX37588.1| chlorophyll a /b binding protein, partial [Beta macrocarpa] gb|ALX37589.1| chlorophyll a /b binding protein, partial [Beta macrocarpa] gb|ALX37590.1| chlorophyll a /b binding protein, partial [Beta macrocarpa] gb|ALX37591.1| chlorophyll a /b binding protein, partial [Beta macrocarpa] gb|ALX37592.1| chlorophyll a /b binding protein, partial [Beta macrocarpa] gb|ALX37593.1| chlorophyll a /b binding protein, partial [Beta macrocarpa] gb|ALX37596.1| chlorophyll a /b binding protein, partial [Beta macrocarpa] gb|ALX37597.1| chlorophyll a /b binding protein, partial [Beta macrocarpa] Length = 163 Score = 80.9 bits (198), Expect = 1e-14 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = -2 Query: 996 AFLGFVIQHNVTGKGPFDNLLQHLSDPWHNTIIQTF 889 AFLGF++QHNVTGKGPFDNLLQHLSDPWHNTIIQTF Sbjct: 125 AFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIIQTF 160 >ref|XP_006374459.1| hypothetical protein POPTR_0015s07340g [Populus trichocarpa] ref|XP_006374460.1| hypothetical protein POPTR_0015s07340g [Populus trichocarpa] Length = 150 Score = 80.5 bits (197), Expect = 1e-14 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = -2 Query: 996 AFLGFVIQHNVTGKGPFDNLLQHLSDPWHNTIIQTF 889 AFLGFVIQHNVTGKGPFDNLLQH+SDPWHNTI+QTF Sbjct: 112 AFLGFVIQHNVTGKGPFDNLLQHISDPWHNTIVQTF 147 >gb|AEX12937.1| hypothetical protein CL1595Contig1_02, partial [Pinus taeda] gb|AEX12938.1| hypothetical protein CL1595Contig1_02, partial [Pinus taeda] gb|AEX12939.1| hypothetical protein CL1595Contig1_02, partial [Pinus taeda] gb|AEX12940.1| hypothetical protein CL1595Contig1_02, partial [Pinus taeda] gb|AEX12941.1| hypothetical protein CL1595Contig1_02, partial [Pinus taeda] gb|AEX12942.1| hypothetical protein CL1595Contig1_02, partial [Pinus taeda] gb|AEX12943.1| hypothetical protein CL1595Contig1_02, partial [Pinus taeda] gb|AEX12944.1| hypothetical protein CL1595Contig1_02, partial [Pinus taeda] gb|AEX12945.1| hypothetical protein CL1595Contig1_02, partial [Pinus taeda] gb|AEX12946.1| hypothetical protein CL1595Contig1_02, partial [Pinus taeda] gb|AEX12947.1| hypothetical protein CL1595Contig1_02, partial [Pinus taeda] gb|AEX12948.1| hypothetical protein CL1595Contig1_02, partial [Pinus taeda] gb|AEX12949.1| hypothetical protein CL1595Contig1_02, partial [Pinus taeda] gb|AEX12950.1| hypothetical protein CL1595Contig1_02, partial [Pinus taeda] Length = 60 Score = 77.4 bits (189), Expect = 1e-14 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = -2 Query: 996 AFLGFVIQHNVTGKGPFDNLLQHLSDPWHNTIIQTFK 886 AFLGFV+QHNVTGKGPFDNLLQHLSDPWHNTIIQ + Sbjct: 22 AFLGFVVQHNVTGKGPFDNLLQHLSDPWHNTIIQVLQ 58 >gb|KHL91182.1| hypothetical protein QW71_36155 [Paenibacillus sp. IHB B 3415] Length = 193 Score = 81.3 bits (199), Expect = 2e-14 Identities = 34/37 (91%), Positives = 37/37 (100%) Frame = -2 Query: 996 AFLGFVIQHNVTGKGPFDNLLQHLSDPWHNTIIQTFK 886 AFLGF++QHNVTGKGPFDNLLQHLSDPWHNTIIQTF+ Sbjct: 155 AFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIIQTFQ 191 >gb|AAG40364.1|AF325012_1 AT3g47470 [Arabidopsis thaliana] Length = 148 Score = 79.3 bits (194), Expect = 3e-14 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = -2 Query: 996 AFLGFVIQHNVTGKGPFDNLLQHLSDPWHNTIIQTF 889 AFLGFV+QHNVTGKGPF+NLLQHLSDPWHNTI+QTF Sbjct: 112 AFLGFVVQHNVTGKGPFENLLQHLSDPWHNTIVQTF 147 >ref|XP_002514741.1| PREDICTED: chlorophyll a-b binding protein P4, chloroplastic [Ricinus communis] gb|EEF47847.1| chlorophyll A/B binding protein, putative [Ricinus communis] Length = 251 Score = 81.6 bits (200), Expect = 3e-14 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = -2 Query: 996 AFLGFVIQHNVTGKGPFDNLLQHLSDPWHNTIIQTF 889 AFLGFVIQHNVTGKGPFDNLLQHLSDPWHNTIIQTF Sbjct: 213 AFLGFVIQHNVTGKGPFDNLLQHLSDPWHNTIIQTF 248 >ref|XP_015883459.1| PREDICTED: chlorophyll a-b binding protein P4, chloroplastic [Ziziphus jujuba] Length = 252 Score = 81.6 bits (200), Expect = 3e-14 Identities = 34/37 (91%), Positives = 37/37 (100%) Frame = -2 Query: 996 AFLGFVIQHNVTGKGPFDNLLQHLSDPWHNTIIQTFK 886 AFLGF++QHNVTGKGPFDNLLQHLSDPWHNTIIQTF+ Sbjct: 214 AFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIIQTFR 250 >gb|EYU24361.1| hypothetical protein MIMGU_mgv1a012416mg [Erythranthe guttata] Length = 186 Score = 80.1 bits (196), Expect = 3e-14 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -2 Query: 996 AFLGFVIQHNVTGKGPFDNLLQHLSDPWHNTIIQTFK 886 AFLGFV+QHNVTGKG FDNLLQHLSDPWHNTIIQTFK Sbjct: 149 AFLGFVVQHNVTGKGAFDNLLQHLSDPWHNTIIQTFK 185 >gb|PNT00702.1| hypothetical protein POPTR_015G062200v3 [Populus trichocarpa] gb|PNT00706.1| hypothetical protein POPTR_015G062200v3 [Populus trichocarpa] Length = 150 Score = 79.0 bits (193), Expect = 4e-14 Identities = 33/36 (91%), Positives = 36/36 (100%) Frame = -2 Query: 996 AFLGFVIQHNVTGKGPFDNLLQHLSDPWHNTIIQTF 889 AFLGFVIQHNVTGKGPF+NLLQH+SDPWHNTI+QTF Sbjct: 112 AFLGFVIQHNVTGKGPFENLLQHISDPWHNTIVQTF 147 >ref|WP_083442875.1| hypothetical protein [Paenibacillus sp. IHB B 3415] Length = 250 Score = 81.3 bits (199), Expect = 4e-14 Identities = 34/37 (91%), Positives = 37/37 (100%) Frame = -2 Query: 996 AFLGFVIQHNVTGKGPFDNLLQHLSDPWHNTIIQTFK 886 AFLGF++QHNVTGKGPFDNLLQHLSDPWHNTIIQTF+ Sbjct: 212 AFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIIQTFQ 248 >ref|XP_020586734.1| chlorophyll a-b binding protein 4, chloroplastic [Phalaenopsis equestris] Length = 253 Score = 81.3 bits (199), Expect = 5e-14 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -2 Query: 996 AFLGFVIQHNVTGKGPFDNLLQHLSDPWHNTIIQTF 889 AFLGF+IQHNVTGKGPFDNLLQHLSDPWHNTIIQTF Sbjct: 216 AFLGFIIQHNVTGKGPFDNLLQHLSDPWHNTIIQTF 251 >gb|ABX71549.1| chloroplast chlorophyll a/b binding protein, partial [Helianthus annuus] gb|ABX71550.1| chloroplast chlorophyll a/b binding protein, partial [Helianthus annuus] gb|ABX71551.1| chloroplast chlorophyll a/b binding protein, partial [Helianthus annuus] gb|ABX71552.1| chloroplast chlorophyll a/b binding protein, partial [Helianthus annuus] gb|ABX71553.1| chloroplast chlorophyll a/b binding protein, partial [Helianthus annuus] gb|ABX71554.1| chloroplast chlorophyll a/b binding protein, partial [Helianthus annuus] gb|ABX71555.1| chloroplast chlorophyll a/b binding protein, partial [Helianthus annuus] gb|ABX71556.1| chloroplast chlorophyll a/b binding protein, partial [Helianthus annuus] gb|ABX71557.1| chloroplast chlorophyll a/b binding protein, partial [Helianthus annuus] gb|ABX71558.1| chloroplast chlorophyll a/b binding protein, partial [Helianthus annuus] gb|ABX71559.1| chloroplast chlorophyll a/b binding protein, partial [Helianthus annuus] gb|ABX71560.1| chloroplast chlorophyll a/b binding protein, partial [Helianthus annuus] gb|ABX71561.1| chloroplast chlorophyll a/b binding protein, partial [Helianthus annuus] gb|ABX71562.1| chloroplast chlorophyll a/b binding protein, partial [Helianthus annuus] gb|ABX71563.1| chloroplast chlorophyll a/b binding protein, partial [Helianthus annuus] gb|ABX71564.1| chloroplast chlorophyll a/b binding protein, partial [Helianthus annuus] gb|ABX71565.1| chloroplast chlorophyll a/b binding protein, partial [Helianthus annuus] gb|ABX71566.1| chloroplast chlorophyll a/b binding protein, partial [Helianthus annuus] gb|ABX71567.1| chloroplast chlorophyll a/b binding protein, partial [Helianthus annuus] Length = 135 Score = 78.2 bits (191), Expect = 5e-14 Identities = 32/35 (91%), Positives = 35/35 (100%) Frame = -2 Query: 996 AFLGFVIQHNVTGKGPFDNLLQHLSDPWHNTIIQT 892 AFLGF++QHNVTGKGPFDNLLQHLSDPWHNTI+QT Sbjct: 97 AFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQT 131 >ref|XP_009804068.1| PREDICTED: chlorophyll a-b binding protein 4, chloroplastic-like [Nicotiana sylvestris] ref|XP_016513630.1| PREDICTED: chlorophyll a-b binding protein 4, chloroplastic-like [Nicotiana tabacum] Length = 249 Score = 80.9 bits (198), Expect = 6e-14 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = -2 Query: 996 AFLGFVIQHNVTGKGPFDNLLQHLSDPWHNTIIQTF 889 AFLGF++QHNVTGKGPFDNLLQHLSDPWHNTIIQTF Sbjct: 212 AFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIIQTF 247 >ref|XP_020277049.1| chlorophyll a-b binding protein 4, chloroplastic [Asparagus officinalis] gb|ONK61014.1| uncharacterized protein A4U43_C08F25200 [Asparagus officinalis] Length = 250 Score = 80.9 bits (198), Expect = 6e-14 Identities = 34/37 (91%), Positives = 37/37 (100%) Frame = -2 Query: 996 AFLGFVIQHNVTGKGPFDNLLQHLSDPWHNTIIQTFK 886 AFLGFV+QHNVTGKGPF+NLLQH+SDPWHNTIIQTFK Sbjct: 214 AFLGFVVQHNVTGKGPFENLLQHISDPWHNTIIQTFK 250