BLASTX nr result
ID: Rehmannia31_contig00004389
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00004389 (458 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS61941.1| hypothetical protein M569_12854 [Genlisea aurea] 94 2e-22 ref|XP_016543923.1| PREDICTED: 40S ribosomal protein S28-like [C... 92 9e-22 gb|AAR83864.1| 28 kDa small subunit ribosomal protein [Capsicum ... 92 9e-22 ref|WP_099357434.1| 30S ribosomal protein S28e [Escherichia coli] 92 1e-21 ref|XP_009599481.1| PREDICTED: 40S ribosomal protein S28 [Nicoti... 92 1e-21 ref|XP_012847390.1| PREDICTED: 40S ribosomal protein S28-2-like ... 92 1e-21 ref|XP_012829691.1| PREDICTED: 40S ribosomal protein S28-2-like ... 92 1e-21 ref|XP_007202837.1| 40S ribosomal protein S28 [Prunus persica] >... 92 1e-21 ref|XP_020410363.1| 40S ribosomal protein S28-like [Prunus persi... 91 2e-21 ref|XP_008241134.1| PREDICTED: 40S ribosomal protein S28-like [P... 91 2e-21 ref|XP_004231537.1| PREDICTED: 40S ribosomal protein S28 [Solanu... 91 2e-21 ref|XP_022859482.1| 40S ribosomal protein S28-2 [Olea europaea v... 91 2e-21 ref|XP_012830852.1| PREDICTED: 40S ribosomal protein S28 [Erythr... 91 2e-21 ref|XP_008391409.1| PREDICTED: 40S ribosomal protein S28 [Malus ... 91 2e-21 ref|XP_006362246.1| PREDICTED: 40S ribosomal protein S28 [Solanu... 91 2e-21 ref|XP_002311925.1| 40S ribosomal protein S28 [Populus trichocar... 91 2e-21 gb|OIT04423.1| 40s ribosomal protein s28 [Nicotiana attenuata] 92 3e-21 ref|XP_011096853.1| 40S ribosomal protein S28-2 [Sesamum indicum... 91 4e-21 ref|XP_008391542.1| PREDICTED: 40S ribosomal protein S28-like [M... 91 4e-21 ref|XP_004299346.1| PREDICTED: 40S ribosomal protein S28 [Fragar... 91 4e-21 >gb|EPS61941.1| hypothetical protein M569_12854 [Genlisea aurea] Length = 65 Score = 93.6 bits (231), Expect = 2e-22 Identities = 42/48 (87%), Positives = 47/48 (97%) Frame = -3 Query: 456 TTKHAVVTKIIGRTGSRGQVTQVRVKFIDDQNRFIMRNVKGPVREGDV 313 TTKHA+V K++GRTGSRGQVTQVRVKF+DDQNRFIMRNVKGPVREGD+ Sbjct: 4 TTKHAIVVKVVGRTGSRGQVTQVRVKFMDDQNRFIMRNVKGPVREGDI 51 >ref|XP_016543923.1| PREDICTED: 40S ribosomal protein S28-like [Capsicum annuum] ref|XP_016543924.1| PREDICTED: 40S ribosomal protein S28-like [Capsicum annuum] gb|PHT43445.1| 40S ribosomal protein S28 [Capsicum baccatum] gb|PHT43446.1| 40S ribosomal protein S28 [Capsicum baccatum] gb|PHT63392.1| 40S ribosomal protein S28 [Capsicum annuum] gb|PHT63393.1| 40S ribosomal protein S28 [Capsicum annuum] gb|PHU06124.1| 40S ribosomal protein S28 [Capsicum chinense] gb|PHU06125.1| 40S ribosomal protein S28 [Capsicum chinense] Length = 65 Score = 92.0 bits (227), Expect = 9e-22 Identities = 43/47 (91%), Positives = 46/47 (97%) Frame = -3 Query: 453 TKHAVVTKIIGRTGSRGQVTQVRVKFIDDQNRFIMRNVKGPVREGDV 313 TKHAVV KI+GRTGSRGQVTQVRVKF+DDQNRFIMRNVKGPVREGD+ Sbjct: 5 TKHAVVVKIMGRTGSRGQVTQVRVKFLDDQNRFIMRNVKGPVREGDI 51 >gb|AAR83864.1| 28 kDa small subunit ribosomal protein [Capsicum annuum] Length = 65 Score = 92.0 bits (227), Expect = 9e-22 Identities = 43/47 (91%), Positives = 46/47 (97%) Frame = -3 Query: 453 TKHAVVTKIIGRTGSRGQVTQVRVKFIDDQNRFIMRNVKGPVREGDV 313 TKHAVV KI+GRTGSRGQVTQVRVKF+DDQNRFIMRNVKGPVREGD+ Sbjct: 5 TKHAVVVKIMGRTGSRGQVTQVRVKFLDDQNRFIMRNVKGPVREGDI 51 >ref|WP_099357434.1| 30S ribosomal protein S28e [Escherichia coli] Length = 65 Score = 91.7 bits (226), Expect = 1e-21 Identities = 42/47 (89%), Positives = 46/47 (97%) Frame = -3 Query: 453 TKHAVVTKIIGRTGSRGQVTQVRVKFIDDQNRFIMRNVKGPVREGDV 313 TKHAVV K++GRTGSRGQVTQVRVKF+DDQNRFIMRNVKGP+REGDV Sbjct: 5 TKHAVVVKVMGRTGSRGQVTQVRVKFLDDQNRFIMRNVKGPIREGDV 51 >ref|XP_009599481.1| PREDICTED: 40S ribosomal protein S28 [Nicotiana tomentosiformis] ref|XP_009599483.1| PREDICTED: 40S ribosomal protein S28 [Nicotiana tomentosiformis] ref|XP_009765085.1| PREDICTED: 40S ribosomal protein S28 [Nicotiana sylvestris] ref|XP_009766491.1| PREDICTED: 40S ribosomal protein S28 [Nicotiana sylvestris] ref|XP_009769489.1| PREDICTED: 40S ribosomal protein S28 [Nicotiana sylvestris] ref|XP_016479459.1| PREDICTED: 40S ribosomal protein S28 [Nicotiana tabacum] ref|XP_016493593.1| PREDICTED: 40S ribosomal protein S28 [Nicotiana tabacum] ref|XP_016495012.1| PREDICTED: 40S ribosomal protein S28 [Nicotiana tabacum] ref|XP_016507494.1| PREDICTED: 40S ribosomal protein S28 [Nicotiana tabacum] ref|XP_016449555.1| PREDICTED: 40S ribosomal protein S28 [Nicotiana tabacum] ref|XP_018625934.1| PREDICTED: 40S ribosomal protein S28 [Nicotiana tomentosiformis] ref|XP_018627516.1| PREDICTED: 40S ribosomal protein S28 [Nicotiana tomentosiformis] ref|XP_018627733.1| PREDICTED: 40S ribosomal protein S28 [Nicotiana tomentosiformis] ref|XP_019232206.1| PREDICTED: 40S ribosomal protein S28 [Nicotiana attenuata] ref|XP_019243133.1| PREDICTED: 40S ribosomal protein S28 [Nicotiana attenuata] ref|XP_019254391.1| PREDICTED: 40S ribosomal protein S28 [Nicotiana attenuata] Length = 65 Score = 91.7 bits (226), Expect = 1e-21 Identities = 42/47 (89%), Positives = 46/47 (97%) Frame = -3 Query: 453 TKHAVVTKIIGRTGSRGQVTQVRVKFIDDQNRFIMRNVKGPVREGDV 313 TKHA+V K++GRTGSRGQVTQVRVKF+DDQNRFIMRNVKGPVREGDV Sbjct: 5 TKHAIVVKVMGRTGSRGQVTQVRVKFLDDQNRFIMRNVKGPVREGDV 51 >ref|XP_012847390.1| PREDICTED: 40S ribosomal protein S28-2-like [Erythranthe guttata] ref|XP_012847391.1| PREDICTED: 40S ribosomal protein S28-2-like [Erythranthe guttata] gb|EYU29002.1| hypothetical protein MIMGU_mgv1a017613mg [Erythranthe guttata] gb|KZV43445.1| hypothetical protein F511_09888 [Dorcoceras hygrometricum] gb|KZV53380.1| hypothetical protein F511_06522 [Dorcoceras hygrometricum] Length = 65 Score = 91.7 bits (226), Expect = 1e-21 Identities = 43/46 (93%), Positives = 45/46 (97%) Frame = -3 Query: 450 KHAVVTKIIGRTGSRGQVTQVRVKFIDDQNRFIMRNVKGPVREGDV 313 KHA+V K+IGRTGSRGQVTQVRVKFIDDQNRFIMRNVKGPVREGDV Sbjct: 6 KHAIVVKVIGRTGSRGQVTQVRVKFIDDQNRFIMRNVKGPVREGDV 51 >ref|XP_012829691.1| PREDICTED: 40S ribosomal protein S28-2-like [Erythranthe guttata] ref|XP_012829695.1| PREDICTED: 40S ribosomal protein S28-2-like [Erythranthe guttata] ref|XP_012839368.1| PREDICTED: 40S ribosomal protein S28-2-like [Erythranthe guttata] ref|XP_012848567.1| PREDICTED: 40S ribosomal protein S28-2-like [Erythranthe guttata] gb|EYU27906.1| hypothetical protein MIMGU_mgv1a017627mg [Erythranthe guttata] gb|EYU35830.1| hypothetical protein MIMGU_mgv1a017600mg [Erythranthe guttata] gb|EYU43629.1| hypothetical protein MIMGU_mgv1a017586mg [Erythranthe guttata] gb|EYU43633.1| hypothetical protein MIMGU_mgv1a017596mg [Erythranthe guttata] Length = 65 Score = 91.7 bits (226), Expect = 1e-21 Identities = 43/46 (93%), Positives = 45/46 (97%) Frame = -3 Query: 450 KHAVVTKIIGRTGSRGQVTQVRVKFIDDQNRFIMRNVKGPVREGDV 313 KHAVV K+IGRTGSRGQVTQVRVKFIDDQNRFIMRNVKGPVREGD+ Sbjct: 6 KHAVVVKVIGRTGSRGQVTQVRVKFIDDQNRFIMRNVKGPVREGDI 51 >ref|XP_007202837.1| 40S ribosomal protein S28 [Prunus persica] ref|XP_008225488.1| PREDICTED: 40S ribosomal protein S28 [Prunus mume] ref|XP_008241138.1| PREDICTED: 40S ribosomal protein S28 [Prunus mume] ref|XP_020417603.1| 40S ribosomal protein S28 [Prunus persica] ref|XP_021804486.1| 40S ribosomal protein S28 [Prunus avium] ref|XP_021834193.1| 40S ribosomal protein S28 [Prunus avium] emb|CAA10101.1| ribosomal protein S28 [Prunus persica] emb|CAA10102.1| ribosomal protein S28 [Prunus persica] emb|CAA10103.1| ribosomal protein S28 [Prunus persica] gb|ONH95713.1| hypothetical protein PRUPE_7G086800 [Prunus persica] gb|ONI10993.1| hypothetical protein PRUPE_4G080900 [Prunus persica] Length = 65 Score = 91.7 bits (226), Expect = 1e-21 Identities = 42/48 (87%), Positives = 46/48 (95%) Frame = -3 Query: 456 TTKHAVVTKIIGRTGSRGQVTQVRVKFIDDQNRFIMRNVKGPVREGDV 313 T KHAVV K++GRTGSRGQVTQVRVKF+DDQNRFIMRNVKGPVREGD+ Sbjct: 4 TVKHAVVVKVMGRTGSRGQVTQVRVKFLDDQNRFIMRNVKGPVREGDI 51 >ref|XP_020410363.1| 40S ribosomal protein S28-like [Prunus persica] gb|ONI35609.1| hypothetical protein PRUPE_1G545600 [Prunus persica] gb|ONI35610.1| hypothetical protein PRUPE_1G545600 [Prunus persica] Length = 65 Score = 91.3 bits (225), Expect = 2e-21 Identities = 42/48 (87%), Positives = 46/48 (95%) Frame = -3 Query: 456 TTKHAVVTKIIGRTGSRGQVTQVRVKFIDDQNRFIMRNVKGPVREGDV 313 T KHAVV K++GRTGSRGQVTQVRVKF+DDQNRFIMRNVKGPVREGD+ Sbjct: 4 TIKHAVVVKVMGRTGSRGQVTQVRVKFLDDQNRFIMRNVKGPVREGDI 51 >ref|XP_008241134.1| PREDICTED: 40S ribosomal protein S28-like [Prunus mume] ref|XP_016651751.1| PREDICTED: 40S ribosomal protein S28-like [Prunus mume] ref|XP_020423427.1| 40S ribosomal protein S28 [Prunus persica] ref|XP_020423428.1| 40S ribosomal protein S28 [Prunus persica] ref|XP_021804488.1| 40S ribosomal protein S28-like [Prunus avium] Length = 65 Score = 91.3 bits (225), Expect = 2e-21 Identities = 42/48 (87%), Positives = 46/48 (95%) Frame = -3 Query: 456 TTKHAVVTKIIGRTGSRGQVTQVRVKFIDDQNRFIMRNVKGPVREGDV 313 T KHAVV K++GRTGSRGQVTQVRVKF+DDQNRFIMRNVKGPVREGD+ Sbjct: 4 TIKHAVVVKVMGRTGSRGQVTQVRVKFLDDQNRFIMRNVKGPVREGDI 51 >ref|XP_004231537.1| PREDICTED: 40S ribosomal protein S28 [Solanum lycopersicum] ref|XP_004249157.1| PREDICTED: 40S ribosomal protein S28 [Solanum lycopersicum] ref|XP_006361542.1| PREDICTED: 40S ribosomal protein S28-like [Solanum tuberosum] ref|XP_010312055.1| PREDICTED: 40S ribosomal protein S28 [Solanum lycopersicum] ref|XP_015063353.1| PREDICTED: 40S ribosomal protein S28 [Solanum pennellii] ref|XP_015088819.1| PREDICTED: 40S ribosomal protein S28 [Solanum pennellii] Length = 65 Score = 91.3 bits (225), Expect = 2e-21 Identities = 42/47 (89%), Positives = 46/47 (97%) Frame = -3 Query: 453 TKHAVVTKIIGRTGSRGQVTQVRVKFIDDQNRFIMRNVKGPVREGDV 313 TKHA+V KI+GRTGSRGQVTQVRVKF+DDQNRFIMRNVKGPVREGD+ Sbjct: 5 TKHAIVIKIMGRTGSRGQVTQVRVKFLDDQNRFIMRNVKGPVREGDI 51 >ref|XP_022859482.1| 40S ribosomal protein S28-2 [Olea europaea var. sylvestris] ref|XP_022899512.1| 40S ribosomal protein S28-2 [Olea europaea var. sylvestris] Length = 65 Score = 90.9 bits (224), Expect = 2e-21 Identities = 43/46 (93%), Positives = 45/46 (97%) Frame = -3 Query: 450 KHAVVTKIIGRTGSRGQVTQVRVKFIDDQNRFIMRNVKGPVREGDV 313 KHA+V KI+GRTGSRGQVTQVRVKFIDDQNRFIMRNVKGPVREGDV Sbjct: 6 KHAIVVKIMGRTGSRGQVTQVRVKFIDDQNRFIMRNVKGPVREGDV 51 >ref|XP_012830852.1| PREDICTED: 40S ribosomal protein S28 [Erythranthe guttata] Length = 65 Score = 90.9 bits (224), Expect = 2e-21 Identities = 41/46 (89%), Positives = 45/46 (97%) Frame = -3 Query: 450 KHAVVTKIIGRTGSRGQVTQVRVKFIDDQNRFIMRNVKGPVREGDV 313 KHA+V K+IGRTGSRGQVTQVRVKF+DDQNRFIMRNVKGPVREGD+ Sbjct: 6 KHAIVVKVIGRTGSRGQVTQVRVKFVDDQNRFIMRNVKGPVREGDI 51 >ref|XP_008391409.1| PREDICTED: 40S ribosomal protein S28 [Malus domestica] Length = 65 Score = 90.9 bits (224), Expect = 2e-21 Identities = 42/48 (87%), Positives = 46/48 (95%) Frame = -3 Query: 456 TTKHAVVTKIIGRTGSRGQVTQVRVKFIDDQNRFIMRNVKGPVREGDV 313 T KHAVV K++GRTGSRGQVTQVRVKF+DDQNRFIMRNVKGPVREGD+ Sbjct: 4 TIKHAVVIKVMGRTGSRGQVTQVRVKFLDDQNRFIMRNVKGPVREGDI 51 >ref|XP_006362246.1| PREDICTED: 40S ribosomal protein S28 [Solanum tuberosum] ref|XP_015158383.1| PREDICTED: 40S ribosomal protein S28 [Solanum tuberosum] Length = 65 Score = 90.9 bits (224), Expect = 2e-21 Identities = 41/47 (87%), Positives = 46/47 (97%) Frame = -3 Query: 453 TKHAVVTKIIGRTGSRGQVTQVRVKFIDDQNRFIMRNVKGPVREGDV 313 TKHA+V K++GRTGSRGQVTQVRVKF+DDQNRFIMRNVKGPVREGD+ Sbjct: 5 TKHAIVIKVMGRTGSRGQVTQVRVKFLDDQNRFIMRNVKGPVREGDI 51 >ref|XP_002311925.1| 40S ribosomal protein S28 [Populus trichocarpa] ref|XP_002315409.1| 40S ribosomal protein S28 [Populus trichocarpa] gb|ABK92734.1| unknown [Populus trichocarpa] gb|ABK92823.1| unknown [Populus trichocarpa] gb|ABK92982.1| unknown [Populus trichocarpa] gb|ABK93268.1| unknown [Populus trichocarpa] gb|PNT18503.1| hypothetical protein POPTR_010G245400v3 [Populus trichocarpa] gb|PNT22097.1| hypothetical protein POPTR_008G013200v3 [Populus trichocarpa] Length = 65 Score = 90.9 bits (224), Expect = 2e-21 Identities = 43/46 (93%), Positives = 45/46 (97%) Frame = -3 Query: 450 KHAVVTKIIGRTGSRGQVTQVRVKFIDDQNRFIMRNVKGPVREGDV 313 KHAVV KI+GRTGSRGQVTQVRVKFIDDQNRFIMRNVKGPVREGD+ Sbjct: 6 KHAVVVKIMGRTGSRGQVTQVRVKFIDDQNRFIMRNVKGPVREGDI 51 >gb|OIT04423.1| 40s ribosomal protein s28 [Nicotiana attenuata] Length = 93 Score = 91.7 bits (226), Expect = 3e-21 Identities = 42/47 (89%), Positives = 46/47 (97%) Frame = -3 Query: 453 TKHAVVTKIIGRTGSRGQVTQVRVKFIDDQNRFIMRNVKGPVREGDV 313 TKHA+V K++GRTGSRGQVTQVRVKF+DDQNRFIMRNVKGPVREGDV Sbjct: 33 TKHAIVVKVMGRTGSRGQVTQVRVKFLDDQNRFIMRNVKGPVREGDV 79 >ref|XP_011096853.1| 40S ribosomal protein S28-2 [Sesamum indicum] ref|XP_011096854.1| 40S ribosomal protein S28-2 [Sesamum indicum] ref|XP_011098157.1| 40S ribosomal protein S28-2 [Sesamum indicum] gb|PIM97534.1| 40S ribosomal protein S28 [Handroanthus impetiginosus] Length = 65 Score = 90.5 bits (223), Expect = 4e-21 Identities = 42/46 (91%), Positives = 45/46 (97%) Frame = -3 Query: 450 KHAVVTKIIGRTGSRGQVTQVRVKFIDDQNRFIMRNVKGPVREGDV 313 KHAVV K++GRTGSRGQVTQVRVKFIDDQNRFIMRNVKGPVREGD+ Sbjct: 6 KHAVVVKVMGRTGSRGQVTQVRVKFIDDQNRFIMRNVKGPVREGDI 51 >ref|XP_008391542.1| PREDICTED: 40S ribosomal protein S28-like [Malus domestica] ref|XP_008391546.1| PREDICTED: 40S ribosomal protein S28-like [Malus domestica] ref|XP_008350229.1| PREDICTED: 40S ribosomal protein S28 [Malus domestica] ref|XP_009374329.1| PREDICTED: 40S ribosomal protein S28 [Pyrus x bretschneideri] ref|XP_009379660.1| PREDICTED: 40S ribosomal protein S28 [Pyrus x bretschneideri] Length = 65 Score = 90.5 bits (223), Expect = 4e-21 Identities = 41/48 (85%), Positives = 46/48 (95%) Frame = -3 Query: 456 TTKHAVVTKIIGRTGSRGQVTQVRVKFIDDQNRFIMRNVKGPVREGDV 313 T KHA+V K++GRTGSRGQVTQVRVKF+DDQNRFIMRNVKGPVREGD+ Sbjct: 4 TIKHAIVIKVMGRTGSRGQVTQVRVKFLDDQNRFIMRNVKGPVREGDI 51 >ref|XP_004299346.1| PREDICTED: 40S ribosomal protein S28 [Fragaria vesca subsp. vesca] ref|XP_004303433.1| PREDICTED: 40S ribosomal protein S28 [Fragaria vesca subsp. vesca] ref|XP_024191291.1| 40S ribosomal protein S28 isoform X2 [Rosa chinensis] ref|XP_024172745.1| 40S ribosomal protein S28 [Rosa chinensis] gb|PRQ16203.1| putative ribosomal protein S28e [Rosa chinensis] Length = 65 Score = 90.5 bits (223), Expect = 4e-21 Identities = 41/48 (85%), Positives = 46/48 (95%) Frame = -3 Query: 456 TTKHAVVTKIIGRTGSRGQVTQVRVKFIDDQNRFIMRNVKGPVREGDV 313 T KHA+V K++GRTGSRGQVTQVRVKF+DDQNRFIMRNVKGPVREGD+ Sbjct: 4 TVKHALVVKVMGRTGSRGQVTQVRVKFLDDQNRFIMRNVKGPVREGDI 51