BLASTX nr result
ID: Rehmannia31_contig00004239
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00004239 (515 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMS58079.1| BEL1-like homeodomain protein 1 [Triticum urartu] 63 2e-08 gb|AQK58839.1| Putative POX domain/homeobox DNA-binding domain f... 62 4e-08 ref|XP_002969077.1| hypothetical protein SELMODRAFT_68227, parti... 60 5e-08 ref|XP_002992851.1| hypothetical protein SELMODRAFT_48157, parti... 60 5e-08 gb|PIA54327.1| hypothetical protein AQUCO_00900697v1 [Aquilegia ... 62 5e-08 gb|PIA54332.1| hypothetical protein AQUCO_00900697v1 [Aquilegia ... 62 5e-08 gb|PIA54325.1| hypothetical protein AQUCO_00900697v1 [Aquilegia ... 62 5e-08 gb|PIN14477.1| Transcription factor MEIS1 [Handroanthus impetigi... 62 7e-08 ref|XP_010931060.1| PREDICTED: BEL1-like homeodomain protein 1 [... 62 7e-08 gb|KZV17133.1| hypothetical protein F511_31203 [Dorcoceras hygro... 62 7e-08 ref|XP_020572836.1| LOW QUALITY PROTEIN: BEL1-like homeodomain p... 62 7e-08 ref|XP_020686609.1| BEL1-like homeodomain protein 1 [Dendrobium ... 62 7e-08 ref|XP_020106551.1| BEL1-like homeodomain protein 1 [Ananas como... 62 7e-08 ref|XP_009420594.2| PREDICTED: BEL1-like homeodomain protein 1 [... 62 7e-08 emb|CDP10596.1| unnamed protein product [Coffea canephora] 62 7e-08 ref|XP_004494251.1| PREDICTED: BEL1-like homeodomain protein 1 [... 62 7e-08 ref|XP_020553279.1| BEL1-like homeodomain protein 1 [Sesamum ind... 62 7e-08 gb|PKA47017.1| BEL1-like homeodomain protein 1 [Apostasia shenzh... 61 8e-08 gb|EYU18114.1| hypothetical protein MIMGU_mgv1a010011mg [Erythra... 61 9e-08 ref|XP_012828641.1| PREDICTED: BEL1-like homeodomain protein 1 [... 61 1e-07 >gb|EMS58079.1| BEL1-like homeodomain protein 1 [Triticum urartu] Length = 400 Score = 63.2 bits (152), Expect = 2e-08 Identities = 30/40 (75%), Positives = 35/40 (87%) Frame = +3 Query: 3 WLFEHFLHPYPKDLDKLMLAKQTELTRSQKSMALDVTEEN 122 WLFEHFLHPYPKD DK+MLAKQT LTRSQ+ M L+ T+E+ Sbjct: 321 WLFEHFLHPYPKDSDKIMLAKQTGLTRSQE-MYLEETKEH 359 >gb|AQK58839.1| Putative POX domain/homeobox DNA-binding domain family protein [Zea mays] Length = 427 Score = 62.0 bits (149), Expect = 4e-08 Identities = 27/37 (72%), Positives = 32/37 (86%) Frame = +3 Query: 3 WLFEHFLHPYPKDLDKLMLAKQTELTRSQKSMALDVT 113 WLFEHFLHPYPKD DK+MLAKQT LTRSQ A++++ Sbjct: 376 WLFEHFLHPYPKDSDKIMLAKQTGLTRSQVGKAVNLS 412 >ref|XP_002969077.1| hypothetical protein SELMODRAFT_68227, partial [Selaginella moellendorffii] gb|EFJ30193.1| hypothetical protein SELMODRAFT_68227, partial [Selaginella moellendorffii] Length = 178 Score = 60.1 bits (144), Expect = 5e-08 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +3 Query: 3 WLFEHFLHPYPKDLDKLMLAKQTELTRSQKS 95 WLFEHFLHPYPKD DK+MLA+QT LTRSQ S Sbjct: 142 WLFEHFLHPYPKDADKMMLARQTGLTRSQVS 172 >ref|XP_002992851.1| hypothetical protein SELMODRAFT_48157, partial [Selaginella moellendorffii] gb|EFJ06042.1| hypothetical protein SELMODRAFT_48157, partial [Selaginella moellendorffii] Length = 178 Score = 60.1 bits (144), Expect = 5e-08 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +3 Query: 3 WLFEHFLHPYPKDLDKLMLAKQTELTRSQKS 95 WLFEHFLHPYPKD DK+MLA+QT LTRSQ S Sbjct: 142 WLFEHFLHPYPKDADKMMLARQTGLTRSQVS 172 >gb|PIA54327.1| hypothetical protein AQUCO_00900697v1 [Aquilegia coerulea] gb|PIA54328.1| hypothetical protein AQUCO_00900697v1 [Aquilegia coerulea] Length = 642 Score = 62.0 bits (149), Expect = 5e-08 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = +3 Query: 3 WLFEHFLHPYPKDLDKLMLAKQTELTRSQKS 95 WLFEHFLHPYPKD DKLMLAKQT LTRSQ S Sbjct: 367 WLFEHFLHPYPKDTDKLMLAKQTGLTRSQVS 397 >gb|PIA54332.1| hypothetical protein AQUCO_00900697v1 [Aquilegia coerulea] Length = 701 Score = 62.0 bits (149), Expect = 5e-08 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = +3 Query: 3 WLFEHFLHPYPKDLDKLMLAKQTELTRSQKS 95 WLFEHFLHPYPKD DKLMLAKQT LTRSQ S Sbjct: 394 WLFEHFLHPYPKDTDKLMLAKQTGLTRSQVS 424 >gb|PIA54325.1| hypothetical protein AQUCO_00900697v1 [Aquilegia coerulea] gb|PIA54326.1| hypothetical protein AQUCO_00900697v1 [Aquilegia coerulea] gb|PIA54329.1| hypothetical protein AQUCO_00900697v1 [Aquilegia coerulea] gb|PIA54330.1| hypothetical protein AQUCO_00900697v1 [Aquilegia coerulea] gb|PIA54331.1| hypothetical protein AQUCO_00900697v1 [Aquilegia coerulea] gb|PIA54333.1| hypothetical protein AQUCO_00900697v1 [Aquilegia coerulea] gb|PIA54334.1| hypothetical protein AQUCO_00900697v1 [Aquilegia coerulea] Length = 722 Score = 62.0 bits (149), Expect = 5e-08 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = +3 Query: 3 WLFEHFLHPYPKDLDKLMLAKQTELTRSQKS 95 WLFEHFLHPYPKD DKLMLAKQT LTRSQ S Sbjct: 415 WLFEHFLHPYPKDTDKLMLAKQTGLTRSQVS 445 >gb|PIN14477.1| Transcription factor MEIS1 [Handroanthus impetiginosus] Length = 599 Score = 61.6 bits (148), Expect = 7e-08 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = +3 Query: 3 WLFEHFLHPYPKDLDKLMLAKQTELTRSQKS 95 WLFEHFLHPYPKD DKLMLAKQT LTRSQ S Sbjct: 289 WLFEHFLHPYPKDSDKLMLAKQTGLTRSQVS 319 >ref|XP_010931060.1| PREDICTED: BEL1-like homeodomain protein 1 [Elaeis guineensis] ref|XP_010931061.1| PREDICTED: BEL1-like homeodomain protein 1 [Elaeis guineensis] Length = 621 Score = 61.6 bits (148), Expect = 7e-08 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = +3 Query: 3 WLFEHFLHPYPKDLDKLMLAKQTELTRSQKS 95 WLFEHFLHPYPKD DKLMLAKQT LTRSQ S Sbjct: 375 WLFEHFLHPYPKDSDKLMLAKQTGLTRSQVS 405 >gb|KZV17133.1| hypothetical protein F511_31203 [Dorcoceras hygrometricum] Length = 628 Score = 61.6 bits (148), Expect = 7e-08 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = +3 Query: 3 WLFEHFLHPYPKDLDKLMLAKQTELTRSQKS 95 WLFEHFLHPYPKD DKLMLAKQT LTRSQ S Sbjct: 388 WLFEHFLHPYPKDSDKLMLAKQTGLTRSQVS 418 >ref|XP_020572836.1| LOW QUALITY PROTEIN: BEL1-like homeodomain protein 1 [Phalaenopsis equestris] Length = 648 Score = 61.6 bits (148), Expect = 7e-08 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = +3 Query: 3 WLFEHFLHPYPKDLDKLMLAKQTELTRSQKS 95 WLFEHFLHPYPKD DKLMLAKQT LTRSQ S Sbjct: 363 WLFEHFLHPYPKDSDKLMLAKQTGLTRSQVS 393 >ref|XP_020686609.1| BEL1-like homeodomain protein 1 [Dendrobium catenatum] ref|XP_020686614.1| BEL1-like homeodomain protein 1 [Dendrobium catenatum] gb|PKU70299.1| BEL1-like homeodomain protein 1 [Dendrobium catenatum] Length = 649 Score = 61.6 bits (148), Expect = 7e-08 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = +3 Query: 3 WLFEHFLHPYPKDLDKLMLAKQTELTRSQKS 95 WLFEHFLHPYPKD DKLMLAKQT LTRSQ S Sbjct: 361 WLFEHFLHPYPKDSDKLMLAKQTGLTRSQVS 391 >ref|XP_020106551.1| BEL1-like homeodomain protein 1 [Ananas comosus] ref|XP_020106552.1| BEL1-like homeodomain protein 1 [Ananas comosus] ref|XP_020106553.1| BEL1-like homeodomain protein 1 [Ananas comosus] ref|XP_020106554.1| BEL1-like homeodomain protein 1 [Ananas comosus] ref|XP_020106555.1| BEL1-like homeodomain protein 1 [Ananas comosus] gb|OAY84667.1| BEL1-like homeodomain protein 1 [Ananas comosus] Length = 665 Score = 61.6 bits (148), Expect = 7e-08 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = +3 Query: 3 WLFEHFLHPYPKDLDKLMLAKQTELTRSQKS 95 WLFEHFLHPYPKD DKLMLAKQT LTRSQ S Sbjct: 349 WLFEHFLHPYPKDSDKLMLAKQTGLTRSQVS 379 >ref|XP_009420594.2| PREDICTED: BEL1-like homeodomain protein 1 [Musa acuminata subsp. malaccensis] Length = 667 Score = 61.6 bits (148), Expect = 7e-08 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = +3 Query: 3 WLFEHFLHPYPKDLDKLMLAKQTELTRSQKS 95 WLFEHFLHPYPKD DKLMLAKQT LTRSQ S Sbjct: 380 WLFEHFLHPYPKDSDKLMLAKQTGLTRSQVS 410 >emb|CDP10596.1| unnamed protein product [Coffea canephora] Length = 680 Score = 61.6 bits (148), Expect = 7e-08 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = +3 Query: 3 WLFEHFLHPYPKDLDKLMLAKQTELTRSQKS 95 WLFEHFLHPYPKD DKLMLAKQT LTRSQ S Sbjct: 416 WLFEHFLHPYPKDSDKLMLAKQTGLTRSQVS 446 >ref|XP_004494251.1| PREDICTED: BEL1-like homeodomain protein 1 [Cicer arietinum] ref|XP_012569592.1| PREDICTED: BEL1-like homeodomain protein 1 [Cicer arietinum] Length = 686 Score = 61.6 bits (148), Expect = 7e-08 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = +3 Query: 3 WLFEHFLHPYPKDLDKLMLAKQTELTRSQKS 95 WLFEHFLHPYPKD DKLMLAKQT LTRSQ S Sbjct: 384 WLFEHFLHPYPKDSDKLMLAKQTGLTRSQVS 414 >ref|XP_020553279.1| BEL1-like homeodomain protein 1 [Sesamum indicum] Length = 712 Score = 61.6 bits (148), Expect = 7e-08 Identities = 28/31 (90%), Positives = 28/31 (90%) Frame = +3 Query: 3 WLFEHFLHPYPKDLDKLMLAKQTELTRSQKS 95 WLFEHFLHPYPKD DKLMLAKQT LTRSQ S Sbjct: 404 WLFEHFLHPYPKDSDKLMLAKQTGLTRSQVS 434 >gb|PKA47017.1| BEL1-like homeodomain protein 1 [Apostasia shenzhenica] Length = 414 Score = 61.2 bits (147), Expect = 8e-08 Identities = 28/32 (87%), Positives = 28/32 (87%) Frame = +3 Query: 3 WLFEHFLHPYPKDLDKLMLAKQTELTRSQKSM 98 WLFEHFLHPYPKD DKLMLAKQT LTRSQ M Sbjct: 370 WLFEHFLHPYPKDSDKLMLAKQTGLTRSQVFM 401 >gb|EYU18114.1| hypothetical protein MIMGU_mgv1a010011mg [Erythranthe guttata] Length = 324 Score = 60.8 bits (146), Expect = 9e-08 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +3 Query: 3 WLFEHFLHPYPKDLDKLMLAKQTELTRSQKS 95 WLFEHFLHPYPKD DK+MLAKQT LTRSQ S Sbjct: 24 WLFEHFLHPYPKDSDKIMLAKQTGLTRSQVS 54 >ref|XP_012828641.1| PREDICTED: BEL1-like homeodomain protein 1 [Erythranthe guttata] Length = 414 Score = 60.8 bits (146), Expect = 1e-07 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +3 Query: 3 WLFEHFLHPYPKDLDKLMLAKQTELTRSQKS 95 WLFEHFLHPYPKD DK+MLAKQT LTRSQ S Sbjct: 114 WLFEHFLHPYPKDSDKIMLAKQTGLTRSQVS 144