BLASTX nr result
ID: Rehmannia31_contig00004129
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00004129 (422 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011084290.1| U-box domain-containing protein 14 [Sesamum ... 80 7e-15 ref|XP_012834964.1| PREDICTED: U-box domain-containing protein 1... 77 2e-13 ref|XP_022841480.1| U-box domain-containing protein 14-like [Ole... 70 3e-11 ref|XP_022842685.1| U-box domain-containing protein 14-like [Ole... 70 4e-11 gb|KZV32822.1| U-box domain-containing protein 14-like [Dorcocer... 68 1e-10 emb|CDO99779.1| unnamed protein product [Coffea canephora] 62 2e-08 ref|XP_009350233.1| PREDICTED: U-box domain-containing protein 1... 59 3e-08 ref|XP_019196759.1| PREDICTED: U-box domain-containing protein 1... 61 5e-08 ref|XP_024176589.1| U-box domain-containing protein 14 [Rosa chi... 60 1e-07 ref|XP_008364702.1| PREDICTED: U-box domain-containing protein 1... 60 1e-07 ref|XP_009368915.1| PREDICTED: U-box domain-containing protein 1... 60 1e-07 ref|XP_004307361.1| PREDICTED: U-box domain-containing protein 1... 59 2e-07 gb|ATP84482.1| ARC1 [Corylus heterophylla x Corylus avellana] 59 2e-07 ref|XP_008362668.1| PREDICTED: U-box domain-containing protein 1... 59 3e-07 ref|XP_021833897.1| U-box domain-containing protein 14 [Prunus a... 58 5e-07 ref|XP_018851608.1| PREDICTED: U-box domain-containing protein 1... 57 8e-07 gb|PHT30701.1| U-box domain-containing protein 13 [Capsicum bacc... 57 1e-06 ref|XP_016550986.1| PREDICTED: U-box domain-containing protein 1... 57 1e-06 ref|XP_010253985.1| PREDICTED: U-box domain-containing protein 1... 57 1e-06 ref|XP_018822947.1| PREDICTED: U-box domain-containing protein 1... 57 2e-06 >ref|XP_011084290.1| U-box domain-containing protein 14 [Sesamum indicum] Length = 632 Score = 80.5 bits (197), Expect = 7e-15 Identities = 38/47 (80%), Positives = 45/47 (95%) Frame = -1 Query: 143 MAENSREETILSQLSESVKAITALPECRTVSRKMYCNLVRRVKLLSP 3 MAEN++EE +LSQLSE V+AI+ALP+CRTVS+KMYCNLVRRVKLLSP Sbjct: 2 MAENTKEEWVLSQLSEYVRAISALPDCRTVSKKMYCNLVRRVKLLSP 48 >ref|XP_012834964.1| PREDICTED: U-box domain-containing protein 14 [Erythranthe guttata] gb|EYU39871.1| hypothetical protein MIMGU_mgv1a002720mg [Erythranthe guttata] Length = 644 Score = 76.6 bits (187), Expect = 2e-13 Identities = 41/47 (87%), Positives = 43/47 (91%) Frame = -1 Query: 143 MAENSREETILSQLSESVKAITALPECRTVSRKMYCNLVRRVKLLSP 3 MAEN EE ILSQLSESVKAITALPEC+TVSRKMY NLVRR+KLLSP Sbjct: 1 MAENP-EEAILSQLSESVKAITALPECKTVSRKMYGNLVRRIKLLSP 46 >ref|XP_022841480.1| U-box domain-containing protein 14-like [Olea europaea var. sylvestris] Length = 629 Score = 70.1 bits (170), Expect = 3e-11 Identities = 34/47 (72%), Positives = 42/47 (89%) Frame = -1 Query: 143 MAENSREETILSQLSESVKAITALPECRTVSRKMYCNLVRRVKLLSP 3 M+E+ RE +LSQ+S SVKAI+ LPECRT+++KMYCNLVRRVKLLSP Sbjct: 1 MSESPRE-AVLSQISYSVKAISGLPECRTIAKKMYCNLVRRVKLLSP 46 >ref|XP_022842685.1| U-box domain-containing protein 14-like [Olea europaea var. sylvestris] Length = 629 Score = 69.7 bits (169), Expect = 4e-11 Identities = 33/47 (70%), Positives = 42/47 (89%) Frame = -1 Query: 143 MAENSREETILSQLSESVKAITALPECRTVSRKMYCNLVRRVKLLSP 3 M +N RE +LS++S+SVKAI+ LP+CRTV++KMYCNLVRRVKLLSP Sbjct: 1 MTDNPRE-AVLSRISDSVKAISGLPDCRTVAKKMYCNLVRRVKLLSP 46 >gb|KZV32822.1| U-box domain-containing protein 14-like [Dorcoceras hygrometricum] Length = 626 Score = 68.2 bits (165), Expect = 1e-10 Identities = 33/47 (70%), Positives = 40/47 (85%) Frame = -1 Query: 143 MAENSREETILSQLSESVKAITALPECRTVSRKMYCNLVRRVKLLSP 3 MAENS+++ +LSQL E V AI LP+CRTVS+KMY NLVRR+KLLSP Sbjct: 1 MAENSKDDDVLSQLCELVDAIYGLPDCRTVSKKMYGNLVRRLKLLSP 47 >emb|CDO99779.1| unnamed protein product [Coffea canephora] Length = 626 Score = 62.0 bits (149), Expect = 2e-08 Identities = 26/41 (63%), Positives = 35/41 (85%) Frame = -1 Query: 125 EETILSQLSESVKAITALPECRTVSRKMYCNLVRRVKLLSP 3 +E +LSQLSE+ + ++ LPECR V +K+YCNLVRR+KLLSP Sbjct: 8 QEALLSQLSEATRTVSTLPECRAVVKKIYCNLVRRIKLLSP 48 >ref|XP_009350233.1| PREDICTED: U-box domain-containing protein 14-like, partial [Pyrus x bretschneideri] Length = 130 Score = 58.5 bits (140), Expect = 3e-08 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = -1 Query: 119 TILSQLSESVKAITALPECRTVSRKMYCNLVRRVKLLSP 3 +++SQL+ESVKAI+ LPECR RKMY N VRRVKLLSP Sbjct: 11 SVVSQLAESVKAISELPECRNAFRKMYGNFVRRVKLLSP 49 >ref|XP_019196759.1| PREDICTED: U-box domain-containing protein 14 [Ipomoea nil] Length = 625 Score = 60.8 bits (146), Expect = 5e-08 Identities = 28/42 (66%), Positives = 37/42 (88%) Frame = -1 Query: 128 REETILSQLSESVKAITALPECRTVSRKMYCNLVRRVKLLSP 3 ++E +L QL+E + AI++LPEC+TVS+KMY NLVRRVKLLSP Sbjct: 4 QKEALLCQLTELIAAISSLPECQTVSKKMYSNLVRRVKLLSP 45 >ref|XP_024176589.1| U-box domain-containing protein 14 [Rosa chinensis] gb|PRQ58746.1| putative aminoacyltransferase, E1 ubiquitin-activating enzyme [Rosa chinensis] Length = 627 Score = 60.1 bits (144), Expect = 1e-07 Identities = 30/47 (63%), Positives = 35/47 (74%) Frame = -1 Query: 143 MAENSREETILSQLSESVKAITALPECRTVSRKMYCNLVRRVKLLSP 3 + E+ ++LSQL +SVKAI LPECR V RKMY N VRRVKLLSP Sbjct: 3 LTEDDPGRSVLSQLVDSVKAIAELPECRNVFRKMYGNFVRRVKLLSP 49 >ref|XP_008364702.1| PREDICTED: U-box domain-containing protein 14 [Malus domestica] Length = 622 Score = 59.7 bits (143), Expect = 1e-07 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = -1 Query: 119 TILSQLSESVKAITALPECRTVSRKMYCNLVRRVKLLSP 3 ++LSQL+ESVKAI+ LPECR RKMY N VRRVKLLSP Sbjct: 6 SVLSQLAESVKAISELPECRNAFRKMYGNFVRRVKLLSP 44 >ref|XP_009368915.1| PREDICTED: U-box domain-containing protein 14 [Pyrus x bretschneideri] Length = 626 Score = 59.7 bits (143), Expect = 1e-07 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = -1 Query: 119 TILSQLSESVKAITALPECRTVSRKMYCNLVRRVKLLSP 3 ++LSQL+ESVKAI+ LPECR RKMY N VRRVKLLSP Sbjct: 6 SVLSQLAESVKAISELPECRNAFRKMYGNFVRRVKLLSP 44 >ref|XP_004307361.1| PREDICTED: U-box domain-containing protein 14 [Fragaria vesca subsp. vesca] Length = 627 Score = 58.9 bits (141), Expect = 2e-07 Identities = 30/45 (66%), Positives = 35/45 (77%) Frame = -1 Query: 137 ENSREETILSQLSESVKAITALPECRTVSRKMYCNLVRRVKLLSP 3 E+ + +LSQL +SVKAI+ LPECR V RKMY N VRRVKLLSP Sbjct: 5 EDHPGKMVLSQLVDSVKAISELPECRNVFRKMYGNFVRRVKLLSP 49 >gb|ATP84482.1| ARC1 [Corylus heterophylla x Corylus avellana] Length = 628 Score = 58.9 bits (141), Expect = 2e-07 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = -1 Query: 125 EETILSQLSESVKAITALPECRTVSRKMYCNLVRRVKLLSP 3 ++++LS+L ESVKAI+ LPECR +KMY NLVRRVKLLSP Sbjct: 8 KDSVLSRLVESVKAISELPECRNACKKMYGNLVRRVKLLSP 48 >ref|XP_008362668.1| PREDICTED: U-box domain-containing protein 14-like [Malus domestica] Length = 631 Score = 58.5 bits (140), Expect = 3e-07 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = -1 Query: 119 TILSQLSESVKAITALPECRTVSRKMYCNLVRRVKLLSP 3 +++SQL+ESVKAI+ LPECR RKMY N VRRVKLLSP Sbjct: 11 SVVSQLAESVKAISELPECRNAFRKMYGNFVRRVKLLSP 49 >ref|XP_021833897.1| U-box domain-containing protein 14 [Prunus avium] Length = 628 Score = 58.2 bits (139), Expect = 5e-07 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = -1 Query: 119 TILSQLSESVKAITALPECRTVSRKMYCNLVRRVKLLSP 3 ++LS+L+ESVKAI+ LPECR RKMY N VRRVKLLSP Sbjct: 11 SVLSRLAESVKAISELPECRNAFRKMYGNFVRRVKLLSP 49 >ref|XP_018851608.1| PREDICTED: U-box domain-containing protein 14-like [Juglans regia] Length = 641 Score = 57.4 bits (137), Expect = 8e-07 Identities = 27/41 (65%), Positives = 34/41 (82%) Frame = -1 Query: 125 EETILSQLSESVKAITALPECRTVSRKMYCNLVRRVKLLSP 3 E+++LS+L ESVK I+ P+CR V +KMY NLVRRVKLLSP Sbjct: 22 EDSVLSRLVESVKTISEFPDCRNVYKKMYGNLVRRVKLLSP 62 >gb|PHT30701.1| U-box domain-containing protein 13 [Capsicum baccatum] Length = 624 Score = 57.0 bits (136), Expect = 1e-06 Identities = 25/41 (60%), Positives = 35/41 (85%) Frame = -1 Query: 125 EETILSQLSESVKAITALPECRTVSRKMYCNLVRRVKLLSP 3 +E +++QL+E + I+ LPECR+VS++MY NLVRRVKLLSP Sbjct: 5 KEDLMNQLTELIDGISGLPECRSVSKRMYSNLVRRVKLLSP 45 >ref|XP_016550986.1| PREDICTED: U-box domain-containing protein 14 [Capsicum annuum] gb|PHT62843.1| U-box domain-containing protein 13 [Capsicum annuum] Length = 624 Score = 57.0 bits (136), Expect = 1e-06 Identities = 25/41 (60%), Positives = 35/41 (85%) Frame = -1 Query: 125 EETILSQLSESVKAITALPECRTVSRKMYCNLVRRVKLLSP 3 +E +++QL+E + I+ LPECR+VS++MY NLVRRVKLLSP Sbjct: 5 KEDLMNQLTELIDGISGLPECRSVSKRMYSNLVRRVKLLSP 45 >ref|XP_010253985.1| PREDICTED: U-box domain-containing protein 14-like [Nelumbo nucifera] Length = 626 Score = 57.0 bits (136), Expect = 1e-06 Identities = 25/38 (65%), Positives = 30/38 (78%) Frame = -1 Query: 116 ILSQLSESVKAITALPECRTVSRKMYCNLVRRVKLLSP 3 ++ QL E VK ++ PECR S+KMYCNLVRRVKLLSP Sbjct: 7 VVDQLVEIVKMVSGFPECRNTSKKMYCNLVRRVKLLSP 44 >ref|XP_018822947.1| PREDICTED: U-box domain-containing protein 14 [Juglans regia] Length = 627 Score = 56.6 bits (135), Expect = 2e-06 Identities = 26/41 (63%), Positives = 36/41 (87%) Frame = -1 Query: 125 EETILSQLSESVKAITALPECRTVSRKMYCNLVRRVKLLSP 3 ++++L +L++SVKAI+ LPECR V +KM+ NLVRRVKLLSP Sbjct: 8 DDSVLIRLADSVKAISELPECRNVCKKMHGNLVRRVKLLSP 48