BLASTX nr result
ID: Rehmannia31_contig00003625
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00003625 (515 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011099562.1| HEAT repeat-containing protein 5B [Sesamum i... 56 8e-06 >ref|XP_011099562.1| HEAT repeat-containing protein 5B [Sesamum indicum] Length = 2244 Score = 55.8 bits (133), Expect = 8e-06 Identities = 32/75 (42%), Positives = 46/75 (61%), Gaps = 8/75 (10%) Frame = +1 Query: 16 YVEPSVEHYHESANIPDS-KVILKDEQGGPVVSTDNSEVTSITDDSSNMSR-------LS 171 + +PS E Y E +IPD+ +I K+EQ PVVST++SE SI D S + LS Sbjct: 2170 HAQPSTEPYDEGTDIPDNGNIIEKNEQETPVVSTNDSEGNSIQDSDSGVHERNSETPILS 2229 Query: 172 DTSDDLENEKKLPGN 216 +T D +++KKLPG+ Sbjct: 2230 NTDDQEDDDKKLPGS 2244