BLASTX nr result
ID: Rehmannia31_contig00003150
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00003150 (360 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022877427.1| multiple organellar RNA editing factor 8, ch... 57 8e-07 ref|XP_011098243.1| multiple organellar RNA editing factor 8, ch... 54 1e-05 >ref|XP_022877427.1| multiple organellar RNA editing factor 8, chloroplastic/mitochondrial-like [Olea europaea var. sylvestris] Length = 452 Score = 56.6 bits (135), Expect = 8e-07 Identities = 30/56 (53%), Positives = 34/56 (60%), Gaps = 9/56 (16%) Frame = +1 Query: 1 QNSNNFGPNMGPSPPVQNQNSYPPNQGQNQG---------AYGNPSLNQNVPGRDV 141 QN N++GPNMG S P QNQNSY P+ G G GNP NQN+PGRDV Sbjct: 392 QNRNSYGPNMG-SVPGQNQNSYGPSTGSGPGQNQNYDPNFGAGNPHQNQNIPGRDV 446 >ref|XP_011098243.1| multiple organellar RNA editing factor 8, chloroplastic/mitochondrial [Sesamum indicum] Length = 440 Score = 53.5 bits (127), Expect = 1e-05 Identities = 29/55 (52%), Positives = 35/55 (63%), Gaps = 10/55 (18%) Frame = +1 Query: 7 SNNFGPNMGPSPPVQNQNSYPPN----QGQNQGAY------GNPSLNQNVPGRDV 141 + N+ PNMGP P NQN+Y PN QGQ+Q Y GNPS +QNVPGRD+ Sbjct: 383 NQNYVPNMGPGP---NQNNYAPNMGPGQGQSQSGYAPGVGGGNPSQSQNVPGRDL 434