BLASTX nr result
ID: Rehmannia31_contig00003127
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00003127 (645 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020551664.1| pentatricopeptide repeat-containing protein ... 118 5e-27 gb|EPS58731.1| hypothetical protein M569_16081, partial [Genlise... 103 9e-25 ref|XP_021900339.1| LOW QUALITY PROTEIN: pentatricopeptide repea... 103 6e-22 ref|XP_021683763.1| pentatricopeptide repeat-containing protein ... 99 2e-20 ref|XP_021683762.1| pentatricopeptide repeat-containing protein ... 99 2e-20 ref|XP_022898620.1| pentatricopeptide repeat-containing protein ... 98 6e-20 ref|XP_022898619.1| pentatricopeptide repeat-containing protein ... 98 6e-20 ref|XP_022898618.1| pentatricopeptide repeat-containing protein ... 98 6e-20 gb|EYU37881.1| hypothetical protein MIMGU_mgv1a002592mg [Erythra... 98 7e-20 ref|XP_012837131.1| PREDICTED: pentatricopeptide repeat-containi... 98 8e-20 ref|XP_021602991.1| pentatricopeptide repeat-containing protein ... 96 5e-19 gb|PON55119.1| Tetratricopeptide-like helical domain containing ... 96 5e-19 gb|PNT41625.1| hypothetical protein POPTR_004G166600v3 [Populus ... 95 7e-19 ref|XP_011037246.1| PREDICTED: pentatricopeptide repeat-containi... 95 7e-19 ref|XP_002306163.2| hypothetical protein POPTR_0004s17400g [Popu... 95 7e-19 ref|XP_011037244.1| PREDICTED: pentatricopeptide repeat-containi... 95 7e-19 ref|XP_002534048.1| PREDICTED: pentatricopeptide repeat-containi... 95 7e-19 ref|XP_007131724.1| hypothetical protein PHAVU_011G0363000g, par... 87 1e-18 ref|XP_004292148.1| PREDICTED: pentatricopeptide repeat-containi... 94 1e-18 gb|PON83396.1| Pentatricopeptide repeat [Trema orientalis] 94 1e-18 >ref|XP_020551664.1| pentatricopeptide repeat-containing protein MRL1, chloroplastic [Sesamum indicum] ref|XP_020551665.1| pentatricopeptide repeat-containing protein MRL1, chloroplastic [Sesamum indicum] Length = 1190 Score = 118 bits (296), Expect = 5e-27 Identities = 56/67 (83%), Positives = 61/67 (91%) Frame = +1 Query: 1 RLGLSYQGNESYGKIRINGVTIRRWFQPKLNSPFNDKRIDLGSSLRHLGSGISRQQRKIR 180 RLGLSYQGNESYGKIRINGV IR+WFQPKL SP+ +K+IDL SS+RHLGSGISRQQRKIR Sbjct: 1124 RLGLSYQGNESYGKIRINGVIIRKWFQPKLGSPYREKKIDLSSSIRHLGSGISRQQRKIR 1183 Query: 181 TGHLSLE 201 T H SLE Sbjct: 1184 TVHFSLE 1190 >gb|EPS58731.1| hypothetical protein M569_16081, partial [Genlisea aurea] Length = 124 Score = 103 bits (257), Expect = 9e-25 Identities = 51/66 (77%), Positives = 56/66 (84%) Frame = +1 Query: 1 RLGLSYQGNESYGKIRINGVTIRRWFQPKLNSPFNDKRIDLGSSLRHLGSGISRQQRKIR 180 RLGLSY GNESYGKIRINGVTIRRWFQPKL S F++K ++L SL HL SGISRQQ KIR Sbjct: 59 RLGLSYIGNESYGKIRINGVTIRRWFQPKLESRFSEKTVNLNPSLTHLSSGISRQQLKIR 118 Query: 181 TGHLSL 198 T +LSL Sbjct: 119 TSYLSL 124 >ref|XP_021900339.1| LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein MRL1, chloroplastic [Carica papaya] Length = 1112 Score = 103 bits (258), Expect = 6e-22 Identities = 50/67 (74%), Positives = 57/67 (85%) Frame = +1 Query: 1 RLGLSYQGNESYGKIRINGVTIRRWFQPKLNSPFNDKRIDLGSSLRHLGSGISRQQRKIR 180 RLGL+YQGNESYGKIRING+T+RRWFQPKL SPF+ K +L SSL LG GIS QQR IR Sbjct: 1046 RLGLTYQGNESYGKIRINGLTLRRWFQPKLASPFSGKPDELNSSLARLGKGISHQQRNIR 1105 Query: 181 TGHLSLE 201 TG+LSL+ Sbjct: 1106 TGNLSLD 1112 >ref|XP_021683763.1| pentatricopeptide repeat-containing protein MRL1, chloroplastic isoform X2 [Hevea brasiliensis] Length = 1095 Score = 99.4 bits (246), Expect = 2e-20 Identities = 48/67 (71%), Positives = 55/67 (82%) Frame = +1 Query: 1 RLGLSYQGNESYGKIRINGVTIRRWFQPKLNSPFNDKRIDLGSSLRHLGSGISRQQRKIR 180 RLGL YQGNESYGKIRING++IRRWFQPKL+SPF+ K +L SS +G GI QQR IR Sbjct: 1029 RLGLPYQGNESYGKIRINGISIRRWFQPKLSSPFSRKPGELSSSQSRIGKGIIHQQRNIR 1088 Query: 181 TGHLSLE 201 TG+LSLE Sbjct: 1089 TGNLSLE 1095 >ref|XP_021683762.1| pentatricopeptide repeat-containing protein MRL1, chloroplastic isoform X1 [Hevea brasiliensis] Length = 1101 Score = 99.4 bits (246), Expect = 2e-20 Identities = 48/67 (71%), Positives = 55/67 (82%) Frame = +1 Query: 1 RLGLSYQGNESYGKIRINGVTIRRWFQPKLNSPFNDKRIDLGSSLRHLGSGISRQQRKIR 180 RLGL YQGNESYGKIRING++IRRWFQPKL+SPF+ K +L SS +G GI QQR IR Sbjct: 1035 RLGLPYQGNESYGKIRINGISIRRWFQPKLSSPFSRKPGELSSSQSRIGKGIIHQQRNIR 1094 Query: 181 TGHLSLE 201 TG+LSLE Sbjct: 1095 TGNLSLE 1101 >ref|XP_022898620.1| pentatricopeptide repeat-containing protein MRL1, chloroplastic isoform X3 [Olea europaea var. sylvestris] Length = 968 Score = 98.2 bits (243), Expect = 6e-20 Identities = 47/67 (70%), Positives = 53/67 (79%) Frame = +1 Query: 1 RLGLSYQGNESYGKIRINGVTIRRWFQPKLNSPFNDKRIDLGSSLRHLGSGISRQQRKIR 180 RLGL+YQGNES+GKIRINGV+I++WFQPKLNSPF K D S LG GI QQR IR Sbjct: 902 RLGLTYQGNESFGKIRINGVSIKKWFQPKLNSPFRGKATDFNSFQARLGRGIIHQQRNIR 961 Query: 181 TGHLSLE 201 TG+LSLE Sbjct: 962 TGNLSLE 968 >ref|XP_022898619.1| pentatricopeptide repeat-containing protein MRL1, chloroplastic isoform X2 [Olea europaea var. sylvestris] Length = 1078 Score = 98.2 bits (243), Expect = 6e-20 Identities = 47/67 (70%), Positives = 53/67 (79%) Frame = +1 Query: 1 RLGLSYQGNESYGKIRINGVTIRRWFQPKLNSPFNDKRIDLGSSLRHLGSGISRQQRKIR 180 RLGL+YQGNES+GKIRINGV+I++WFQPKLNSPF K D S LG GI QQR IR Sbjct: 1012 RLGLTYQGNESFGKIRINGVSIKKWFQPKLNSPFRGKATDFNSFQARLGRGIIHQQRNIR 1071 Query: 181 TGHLSLE 201 TG+LSLE Sbjct: 1072 TGNLSLE 1078 >ref|XP_022898618.1| pentatricopeptide repeat-containing protein MRL1, chloroplastic isoform X1 [Olea europaea var. sylvestris] Length = 1091 Score = 98.2 bits (243), Expect = 6e-20 Identities = 47/67 (70%), Positives = 53/67 (79%) Frame = +1 Query: 1 RLGLSYQGNESYGKIRINGVTIRRWFQPKLNSPFNDKRIDLGSSLRHLGSGISRQQRKIR 180 RLGL+YQGNES+GKIRINGV+I++WFQPKLNSPF K D S LG GI QQR IR Sbjct: 1025 RLGLTYQGNESFGKIRINGVSIKKWFQPKLNSPFRGKATDFNSFQARLGRGIIHQQRNIR 1084 Query: 181 TGHLSLE 201 TG+LSLE Sbjct: 1085 TGNLSLE 1091 >gb|EYU37881.1| hypothetical protein MIMGU_mgv1a002592mg [Erythranthe guttata] Length = 656 Score = 97.8 bits (242), Expect = 7e-20 Identities = 44/65 (67%), Positives = 55/65 (84%) Frame = +1 Query: 1 RLGLSYQGNESYGKIRINGVTIRRWFQPKLNSPFNDKRIDLGSSLRHLGSGISRQQRKIR 180 RLGLSYQGNES+GK+++NG+TIR W QP+L +PF K+ID G LR LGS +SRQ++KIR Sbjct: 591 RLGLSYQGNESFGKMKLNGLTIRMWLQPELGTPFGGKKIDRGPPLRRLGSDLSRQRQKIR 650 Query: 181 TGHLS 195 TGHLS Sbjct: 651 TGHLS 655 >ref|XP_012837131.1| PREDICTED: pentatricopeptide repeat-containing protein MRL1, chloroplastic [Erythranthe guttata] Length = 1102 Score = 97.8 bits (242), Expect = 8e-20 Identities = 44/65 (67%), Positives = 55/65 (84%) Frame = +1 Query: 1 RLGLSYQGNESYGKIRINGVTIRRWFQPKLNSPFNDKRIDLGSSLRHLGSGISRQQRKIR 180 RLGLSYQGNES+GK+++NG+TIR W QP+L +PF K+ID G LR LGS +SRQ++KIR Sbjct: 1037 RLGLSYQGNESFGKMKLNGLTIRMWLQPELGTPFGGKKIDRGPPLRRLGSDLSRQRQKIR 1096 Query: 181 TGHLS 195 TGHLS Sbjct: 1097 TGHLS 1101 >ref|XP_021602991.1| pentatricopeptide repeat-containing protein MRL1, chloroplastic [Manihot esculenta] gb|OAY21449.1| hypothetical protein MANES_S086100 [Manihot esculenta] Length = 1098 Score = 95.5 bits (236), Expect = 5e-19 Identities = 46/67 (68%), Positives = 55/67 (82%) Frame = +1 Query: 1 RLGLSYQGNESYGKIRINGVTIRRWFQPKLNSPFNDKRIDLGSSLRHLGSGISRQQRKIR 180 R+GL YQGNESYGKIRINGV+++RWFQPKL+SPF+ K +L SS +G GI QQR IR Sbjct: 1032 RIGLPYQGNESYGKIRINGVSLKRWFQPKLSSPFSRKPGELSSSQLIIGKGIIHQQRNIR 1091 Query: 181 TGHLSLE 201 TG+LSLE Sbjct: 1092 TGNLSLE 1098 >gb|PON55119.1| Tetratricopeptide-like helical domain containing protein [Parasponia andersonii] Length = 1134 Score = 95.5 bits (236), Expect = 5e-19 Identities = 46/67 (68%), Positives = 54/67 (80%) Frame = +1 Query: 1 RLGLSYQGNESYGKIRINGVTIRRWFQPKLNSPFNDKRIDLGSSLRHLGSGISRQQRKIR 180 RLGLSYQGNESYGKIRING+TI+RWF PKL SPF+ K ++ S LG GI+ QQR IR Sbjct: 1068 RLGLSYQGNESYGKIRINGLTIKRWFMPKLASPFSGKPEEINLSQFRLGKGIAHQQRNIR 1127 Query: 181 TGHLSLE 201 TG+LSL+ Sbjct: 1128 TGNLSLD 1134 >gb|PNT41625.1| hypothetical protein POPTR_004G166600v3 [Populus trichocarpa] Length = 1104 Score = 95.1 bits (235), Expect = 7e-19 Identities = 46/67 (68%), Positives = 53/67 (79%) Frame = +1 Query: 1 RLGLSYQGNESYGKIRINGVTIRRWFQPKLNSPFNDKRIDLGSSLRHLGSGISRQQRKIR 180 RLGL YQGNESYGKIRING+++RRW QPKL+SPF+ K + +SL LG GIS QQR IR Sbjct: 1038 RLGLPYQGNESYGKIRINGISLRRWLQPKLDSPFSGKPGEWSTSLSRLGKGISFQQRNIR 1097 Query: 181 TGHLSLE 201 TG SLE Sbjct: 1098 TGDFSLE 1104 >ref|XP_011037246.1| PREDICTED: pentatricopeptide repeat-containing protein MRL1, chloroplastic isoform X2 [Populus euphratica] Length = 1104 Score = 95.1 bits (235), Expect = 7e-19 Identities = 46/67 (68%), Positives = 53/67 (79%) Frame = +1 Query: 1 RLGLSYQGNESYGKIRINGVTIRRWFQPKLNSPFNDKRIDLGSSLRHLGSGISRQQRKIR 180 RLGL YQGNESYGKIRING+++RRW QPKL+SPF+ K + +SL LG GIS QQR IR Sbjct: 1038 RLGLPYQGNESYGKIRINGISLRRWLQPKLDSPFSGKPGEWSTSLSRLGKGISFQQRNIR 1097 Query: 181 TGHLSLE 201 TG SLE Sbjct: 1098 TGDFSLE 1104 >ref|XP_002306163.2| hypothetical protein POPTR_0004s17400g [Populus trichocarpa] Length = 1104 Score = 95.1 bits (235), Expect = 7e-19 Identities = 46/67 (68%), Positives = 53/67 (79%) Frame = +1 Query: 1 RLGLSYQGNESYGKIRINGVTIRRWFQPKLNSPFNDKRIDLGSSLRHLGSGISRQQRKIR 180 RLGL YQGNESYGKIRING+++RRW QPKL+SPF+ K + +SL LG GIS QQR IR Sbjct: 1038 RLGLPYQGNESYGKIRINGISLRRWLQPKLDSPFSGKPGEWSTSLSRLGKGISFQQRNIR 1097 Query: 181 TGHLSLE 201 TG SLE Sbjct: 1098 TGDFSLE 1104 >ref|XP_011037244.1| PREDICTED: pentatricopeptide repeat-containing protein MRL1, chloroplastic isoform X1 [Populus euphratica] Length = 1109 Score = 95.1 bits (235), Expect = 7e-19 Identities = 46/67 (68%), Positives = 53/67 (79%) Frame = +1 Query: 1 RLGLSYQGNESYGKIRINGVTIRRWFQPKLNSPFNDKRIDLGSSLRHLGSGISRQQRKIR 180 RLGL YQGNESYGKIRING+++RRW QPKL+SPF+ K + +SL LG GIS QQR IR Sbjct: 1043 RLGLPYQGNESYGKIRINGISLRRWLQPKLDSPFSGKPGEWSTSLSRLGKGISFQQRNIR 1102 Query: 181 TGHLSLE 201 TG SLE Sbjct: 1103 TGDFSLE 1109 >ref|XP_002534048.1| PREDICTED: pentatricopeptide repeat-containing protein MRL1, chloroplastic [Ricinus communis] gb|EEF28334.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 1129 Score = 95.1 bits (235), Expect = 7e-19 Identities = 45/66 (68%), Positives = 53/66 (80%) Frame = +1 Query: 1 RLGLSYQGNESYGKIRINGVTIRRWFQPKLNSPFNDKRIDLGSSLRHLGSGISRQQRKIR 180 RLGL YQGNESYGKIRING+++RRW QPKL SPF+ K +L SL +G GI+ QQR IR Sbjct: 1063 RLGLPYQGNESYGKIRINGISLRRWLQPKLASPFSGKPEELSFSLSRIGKGITHQQRNIR 1122 Query: 181 TGHLSL 198 TG+LSL Sbjct: 1123 TGNLSL 1128 >ref|XP_007131724.1| hypothetical protein PHAVU_011G0363000g, partial [Phaseolus vulgaris] gb|ESW03718.1| hypothetical protein PHAVU_011G0363000g, partial [Phaseolus vulgaris] Length = 108 Score = 87.4 bits (215), Expect = 1e-18 Identities = 42/67 (62%), Positives = 51/67 (76%) Frame = +1 Query: 1 RLGLSYQGNESYGKIRINGVTIRRWFQPKLNSPFNDKRIDLGSSLRHLGSGISRQQRKIR 180 RL + +QGNESYGK+RINGV ++ WFQPKL SPF+ K D SS+ LG GIS QQR IR Sbjct: 42 RLQIPHQGNESYGKLRINGVALKIWFQPKLASPFSGKPGDWSSSMSRLGKGISHQQRNIR 101 Query: 181 TGHLSLE 201 G+LSL+ Sbjct: 102 IGNLSLD 108 >ref|XP_004292148.1| PREDICTED: pentatricopeptide repeat-containing protein MRL1, chloroplastic [Fragaria vesca subsp. vesca] Length = 1028 Score = 94.4 bits (233), Expect = 1e-18 Identities = 45/67 (67%), Positives = 53/67 (79%) Frame = +1 Query: 1 RLGLSYQGNESYGKIRINGVTIRRWFQPKLNSPFNDKRIDLGSSLRHLGSGISRQQRKIR 180 RLG+ YQGNES GKIRI+G+T++RWFQPKL SPF K +LGSS LG GI QQR IR Sbjct: 962 RLGIDYQGNESRGKIRISGLTLKRWFQPKLASPFTGKLAELGSSQLRLGKGIMHQQRNIR 1021 Query: 181 TGHLSLE 201 TG+LSL+ Sbjct: 1022 TGNLSLD 1028 >gb|PON83396.1| Pentatricopeptide repeat [Trema orientalis] Length = 1137 Score = 94.4 bits (233), Expect = 1e-18 Identities = 46/67 (68%), Positives = 54/67 (80%) Frame = +1 Query: 1 RLGLSYQGNESYGKIRINGVTIRRWFQPKLNSPFNDKRIDLGSSLRHLGSGISRQQRKIR 180 RLGLSYQGNESYGKIRING+TI+RWF PKL SPF+ K ++ S LG GI+ QQR IR Sbjct: 1071 RLGLSYQGNESYGKIRINGLTIKRWFIPKLASPFSGKPEEINLSQFRLGKGIAHQQRNIR 1130 Query: 181 TGHLSLE 201 TG+LSL+ Sbjct: 1131 TGNLSLD 1137