BLASTX nr result
ID: Rehmannia31_contig00002925
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00002925 (1297 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011089468.1| heterogeneous nuclear ribonucleoprotein 1 [S... 60 3e-06 >ref|XP_011089468.1| heterogeneous nuclear ribonucleoprotein 1 [Sesamum indicum] Length = 344 Score = 60.1 bits (144), Expect = 3e-06 Identities = 37/95 (38%), Positives = 37/95 (38%) Frame = +2 Query: 167 EIKKAEPKKPSNQTPGPAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPASYRSMXXXXX 346 EIKKAEPKKPSN TP PA PASYRSM Sbjct: 175 EIKKAEPKKPSNPTPAPAYGSDSRARAYGDSYGGFGSSYSSFGSGGFGPASYRSMGSGLG 234 Query: 347 XXXXXXXXXXXXXXXXXXXXDYGSSEFGYRGDGPL 451 DY SSEFGYRGDGPL Sbjct: 235 GRFGDYGGYGGGSEFGGRYGDYASSEFGYRGDGPL 269