BLASTX nr result
ID: Rehmannia31_contig00002123
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00002123 (754 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN19726.1| hypothetical protein CDL12_07591 [Handroanthus im... 61 4e-08 gb|PIN19725.1| hypothetical protein CDL12_07590 [Handroanthus im... 55 1e-05 >gb|PIN19726.1| hypothetical protein CDL12_07591 [Handroanthus impetiginosus] Length = 148 Score = 61.2 bits (147), Expect = 4e-08 Identities = 25/58 (43%), Positives = 41/58 (70%) Frame = -1 Query: 754 AKIEDQVPIKCAAPKAYNFFKNDLTKLTSIAPQLFQSVKEVDGNKGQVGGVVQFEFYI 581 AKIE + IKC+ K Y+FFKN +T+ +I PQ+++ V+ ++G +GQ G ++ FE+ I Sbjct: 5 AKIEAKAEIKCSPAKVYDFFKNKMTQFPNIYPQVYKKVELLEGEEGQAGNIIHFEYVI 62 >gb|PIN19725.1| hypothetical protein CDL12_07590 [Handroanthus impetiginosus] Length = 148 Score = 54.7 bits (130), Expect = 1e-05 Identities = 23/58 (39%), Positives = 38/58 (65%) Frame = -1 Query: 754 AKIEDQVPIKCAAPKAYNFFKNDLTKLTSIAPQLFQSVKEVDGNKGQVGGVVQFEFYI 581 AKIE + IKC+ K ++FFK L + ++ PQ F+ V+ ++G +GQ G ++ FE+ I Sbjct: 5 AKIEAKAEIKCSPAKVFDFFKYKLKQFPNLYPQAFKKVELLEGEEGQAGNIIHFEYVI 62