BLASTX nr result
ID: Rehmannia31_contig00001874
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00001874 (408 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC17474.1| hypothetical protein L484_001316 [Morus notabilis] 50 1e-07 >gb|EXC17474.1| hypothetical protein L484_001316 [Morus notabilis] Length = 335 Score = 49.7 bits (117), Expect(2) = 1e-07 Identities = 22/41 (53%), Positives = 29/41 (70%) Frame = -1 Query: 408 CDMFISDKWQRTSLRNKWNRSKQRWNSTQGRISYTQHRFKK 286 CD F DK+Q+ S NK NRS Q++ S G++SY+QHR KK Sbjct: 177 CDRFSGDKFQKISETNKTNRSNQKYPSLHGQVSYSQHRNKK 217 Score = 33.5 bits (75), Expect(2) = 1e-07 Identities = 11/34 (32%), Positives = 21/34 (61%) Frame = -2 Query: 224 NEHAIMREILGQRRGHMTGIGPRLPRRTFAATHP 123 +EH ++ ++LG RRGH + P L ++ ++ P Sbjct: 241 DEHGVLEQVLGMRRGHKIRVDPTLSQKYYSRASP 274