BLASTX nr result
ID: Rehmannia31_contig00001395
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00001395 (406 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN27034.1| CREB binding protein/P300 [Handroanthus impetigin... 67 2e-10 gb|PIN25520.1| CREB binding protein/P300 [Handroanthus impetigin... 67 2e-10 ref|XP_011072007.1| BTB/POZ and TAZ domain-containing protein 1 ... 67 2e-10 gb|KZV06740.1| hypothetical protein F511_45778 [Dorcoceras hygro... 62 6e-10 gb|PHT86162.1| BTB/POZ and TAZ domain-containing protein 2 [Caps... 65 9e-10 ref|XP_012855703.1| PREDICTED: BTB/POZ and TAZ domain-containing... 65 9e-10 gb|PHU16529.1| BTB/POZ and TAZ domain-containing protein 2 [Caps... 65 9e-10 gb|PHT53763.1| BTB/POZ and TAZ domain-containing protein 2 [Caps... 65 9e-10 ref|XP_016563747.1| PREDICTED: BTB/POZ and TAZ domain-containing... 65 9e-10 ref|XP_020552136.1| BTB/POZ and TAZ domain-containing protein 1 ... 65 1e-09 ref|XP_015070837.1| PREDICTED: BTB/POZ and TAZ domain-containing... 65 2e-09 ref|XP_009631180.1| PREDICTED: BTB/POZ and TAZ domain-containing... 65 2e-09 ref|XP_006351442.1| PREDICTED: BTB/POZ and TAZ domain-containing... 65 2e-09 ref|XP_004236301.1| PREDICTED: BTB/POZ and TAZ domain-containing... 65 2e-09 ref|XP_011086988.1| BTB/POZ and TAZ domain-containing protein 1 ... 65 2e-09 ref|XP_020552135.1| BTB/POZ and TAZ domain-containing protein 1 ... 64 2e-09 ref|XP_022885341.1| BTB/POZ and TAZ domain-containing protein 1 ... 64 2e-09 ref|XP_022737118.1| BTB/POZ and TAZ domain-containing protein 1-... 64 2e-09 ref|XP_019241563.1| PREDICTED: BTB/POZ and TAZ domain-containing... 64 3e-09 ref|XP_019229782.1| PREDICTED: BTB/POZ and TAZ domain-containing... 64 3e-09 >gb|PIN27034.1| CREB binding protein/P300 [Handroanthus impetiginosus] Length = 359 Score = 67.4 bits (163), Expect = 2e-10 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +1 Query: 1 RCKRMWQLFKLHSSICDQPDECRVPLCRYINI 96 RCKRMWQLF+LHSSICDQPDECRVPLCR + Sbjct: 274 RCKRMWQLFRLHSSICDQPDECRVPLCRQFKL 305 >gb|PIN25520.1| CREB binding protein/P300 [Handroanthus impetiginosus] Length = 359 Score = 67.4 bits (163), Expect = 2e-10 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +1 Query: 1 RCKRMWQLFKLHSSICDQPDECRVPLCRYINI 96 RCKRMWQLF+LHSSICDQPDECRVPLCR + Sbjct: 274 RCKRMWQLFRLHSSICDQPDECRVPLCRQFKL 305 >ref|XP_011072007.1| BTB/POZ and TAZ domain-containing protein 1 [Sesamum indicum] Length = 360 Score = 67.4 bits (163), Expect = 2e-10 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +1 Query: 1 RCKRMWQLFKLHSSICDQPDECRVPLCRYINI 96 RCKRMWQLF+LHSSICDQPDECRVPLCR + Sbjct: 273 RCKRMWQLFRLHSSICDQPDECRVPLCRQFKL 304 >gb|KZV06740.1| hypothetical protein F511_45778 [Dorcoceras hygrometricum] Length = 91 Score = 62.0 bits (149), Expect = 6e-10 Identities = 24/28 (85%), Positives = 27/28 (96%) Frame = +1 Query: 1 RCKRMWQLFKLHSSICDQPDECRVPLCR 84 RC RMWQLF+LHSSICDQP+ECRVPLC+ Sbjct: 64 RCSRMWQLFRLHSSICDQPEECRVPLCQ 91 >gb|PHT86162.1| BTB/POZ and TAZ domain-containing protein 2 [Capsicum annuum] Length = 346 Score = 65.5 bits (158), Expect = 9e-10 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +1 Query: 1 RCKRMWQLFKLHSSICDQPDECRVPLCRYINI 96 RCKRMWQL +LHSSICDQPDECRVPLCR + Sbjct: 259 RCKRMWQLLRLHSSICDQPDECRVPLCRQFKV 290 >ref|XP_012855703.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 1 [Erythranthe guttata] gb|EYU22242.1| hypothetical protein MIMGU_mgv1a009133mg [Erythranthe guttata] Length = 352 Score = 65.5 bits (158), Expect = 9e-10 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +1 Query: 1 RCKRMWQLFKLHSSICDQPDECRVPLCRYINI 96 RC RMWQLFKLHSS+CDQPDECRVPLCR + Sbjct: 274 RCNRMWQLFKLHSSMCDQPDECRVPLCRQFKL 305 >gb|PHU16529.1| BTB/POZ and TAZ domain-containing protein 2 [Capsicum chinense] Length = 354 Score = 65.5 bits (158), Expect = 9e-10 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +1 Query: 1 RCKRMWQLFKLHSSICDQPDECRVPLCRYINI 96 RCKRMWQL +LHSSICDQPDECRVPLCR + Sbjct: 267 RCKRMWQLLRLHSSICDQPDECRVPLCRQFKV 298 >gb|PHT53763.1| BTB/POZ and TAZ domain-containing protein 2 [Capsicum baccatum] Length = 354 Score = 65.5 bits (158), Expect = 9e-10 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +1 Query: 1 RCKRMWQLFKLHSSICDQPDECRVPLCRYINI 96 RCKRMWQL +LHSSICDQPDECRVPLCR + Sbjct: 267 RCKRMWQLLRLHSSICDQPDECRVPLCRQFKV 298 >ref|XP_016563747.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like [Capsicum annuum] Length = 354 Score = 65.5 bits (158), Expect = 9e-10 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +1 Query: 1 RCKRMWQLFKLHSSICDQPDECRVPLCRYINI 96 RCKRMWQL +LHSSICDQPDECRVPLCR + Sbjct: 267 RCKRMWQLLRLHSSICDQPDECRVPLCRQFKV 298 >ref|XP_020552136.1| BTB/POZ and TAZ domain-containing protein 1 isoform X3 [Sesamum indicum] Length = 262 Score = 64.7 bits (156), Expect = 1e-09 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +1 Query: 1 RCKRMWQLFKLHSSICDQPDECRVPLCRYINI 96 RCKRMWQLF+LHSSIC QPDECRVPLCR + Sbjct: 175 RCKRMWQLFRLHSSICGQPDECRVPLCRQFKL 206 >ref|XP_015070837.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 1 [Solanum pennellii] Length = 345 Score = 64.7 bits (156), Expect = 2e-09 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = +1 Query: 1 RCKRMWQLFKLHSSICDQPDECRVPLCR 84 RCKRMWQL +LHSSICDQPDECRVPLCR Sbjct: 258 RCKRMWQLLRLHSSICDQPDECRVPLCR 285 >ref|XP_009631180.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like [Nicotiana tomentosiformis] ref|XP_016449066.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like isoform X1 [Nicotiana tabacum] Length = 345 Score = 64.7 bits (156), Expect = 2e-09 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +1 Query: 1 RCKRMWQLFKLHSSICDQPDECRVPLCRYINI 96 RCKRMWQL +LHSSICD+PDECRVPLCR + + Sbjct: 264 RCKRMWQLLRLHSSICDKPDECRVPLCRQLKV 295 >ref|XP_006351442.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 1 [Solanum tuberosum] Length = 345 Score = 64.7 bits (156), Expect = 2e-09 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = +1 Query: 1 RCKRMWQLFKLHSSICDQPDECRVPLCR 84 RCKRMWQL +LHSSICDQPDECRVPLCR Sbjct: 258 RCKRMWQLLRLHSSICDQPDECRVPLCR 285 >ref|XP_004236301.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 1 [Solanum lycopersicum] Length = 345 Score = 64.7 bits (156), Expect = 2e-09 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = +1 Query: 1 RCKRMWQLFKLHSSICDQPDECRVPLCR 84 RCKRMWQL +LHSSICDQPDECRVPLCR Sbjct: 258 RCKRMWQLLRLHSSICDQPDECRVPLCR 285 >ref|XP_011086988.1| BTB/POZ and TAZ domain-containing protein 1 isoform X1 [Sesamum indicum] Length = 353 Score = 64.7 bits (156), Expect = 2e-09 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +1 Query: 1 RCKRMWQLFKLHSSICDQPDECRVPLCRYINI 96 RCKRMWQLF+LHSSIC QPDECRVPLCR + Sbjct: 266 RCKRMWQLFRLHSSICGQPDECRVPLCRQFKL 297 >ref|XP_020552135.1| BTB/POZ and TAZ domain-containing protein 1 isoform X2 [Sesamum indicum] Length = 301 Score = 64.3 bits (155), Expect = 2e-09 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = +1 Query: 1 RCKRMWQLFKLHSSICDQPDECRVPLCR 84 RCKRMWQLF+LHSSIC QPDECRVPLCR Sbjct: 266 RCKRMWQLFRLHSSICGQPDECRVPLCR 293 >ref|XP_022885341.1| BTB/POZ and TAZ domain-containing protein 1 [Olea europaea var. sylvestris] Length = 350 Score = 64.3 bits (155), Expect = 2e-09 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +1 Query: 1 RCKRMWQLFKLHSSICDQPDECRVPLCRYINI 96 RCKRMWQLF+LHSSICDQ DECRVPLCR + Sbjct: 272 RCKRMWQLFRLHSSICDQTDECRVPLCRQFKL 303 >ref|XP_022737118.1| BTB/POZ and TAZ domain-containing protein 1-like isoform X1 [Durio zibethinus] Length = 381 Score = 64.3 bits (155), Expect = 2e-09 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = +1 Query: 1 RCKRMWQLFKLHSSICDQPDECRVPLCRY 87 RCKRMWQL +LHSSICDQPD C+VPLCRY Sbjct: 271 RCKRMWQLLRLHSSICDQPDSCKVPLCRY 299 >ref|XP_019241563.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like [Nicotiana attenuata] gb|OIT19358.1| btbpoz and taz domain-containing protein 1 [Nicotiana attenuata] Length = 351 Score = 63.9 bits (154), Expect = 3e-09 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +1 Query: 1 RCKRMWQLFKLHSSICDQPDECRVPLCRYINI 96 RCKRMWQL +LHSSICD+PDECRVPLCR + Sbjct: 264 RCKRMWQLLRLHSSICDKPDECRVPLCRQFKV 295 >ref|XP_019229782.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like [Nicotiana attenuata] gb|OIT06382.1| btbpoz and taz domain-containing protein 1 [Nicotiana attenuata] Length = 351 Score = 63.9 bits (154), Expect = 3e-09 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +1 Query: 1 RCKRMWQLFKLHSSICDQPDECRVPLCRYINI 96 RCKRMWQL +LHSSICD+PDECRVPLCR + Sbjct: 264 RCKRMWQLLRLHSSICDKPDECRVPLCRQFKV 295