BLASTX nr result
ID: Rehmannia31_contig00001348
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00001348 (386 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012854299.1| PREDICTED: probable phospholipid hydroperoxi... 194 5e-61 ref|XP_011080969.1| probable phospholipid hydroperoxide glutathi... 192 2e-60 emb|CAJ43709.1| glutathion peroxidase [Plantago major] 184 4e-57 gb|KZV16091.1| putative phospholipid hydroperoxide glutathione p... 183 6e-57 gb|PIN11872.1| Glutathione peroxidase [Handroanthus impetiginosu... 186 6e-57 ref|XP_022846194.1| probable phospholipid hydroperoxide glutathi... 182 9e-57 ref|XP_022845507.1| probable phospholipid hydroperoxide glutathi... 182 2e-56 ref|XP_003630521.2| phospholipid hydroperoxide glutathione perox... 182 2e-56 ref|XP_020217472.1| probable phospholipid hydroperoxide glutathi... 184 2e-56 ref|NP_001105091.1| GP protein [Zea mays] >gi|22268405|gb|AAM888... 181 3e-56 gb|PON84601.1| Glutathione peroxidase [Trema orientalis] 181 5e-56 gb|APZ73851.1| glutathione peroxidase [Populus euphratica] >gi|1... 181 5e-56 ref|XP_011072526.1| probable phospholipid hydroperoxide glutathi... 181 5e-56 dbj|GAV57939.1| GSHPx domain-containing protein [Cephalotus foll... 183 5e-56 emb|CDP09749.1| unnamed protein product [Coffea canephora] 181 7e-56 gb|AFA36624.1| glutathione peroxidase-like protein, partial [Lol... 178 8e-56 gb|KQL30844.1| hypothetical protein SETIT_018223mg [Setaria ital... 180 9e-56 gb|AFP99878.1| glutathione peroxidase, partial [Medicago sativa] 182 1e-55 gb|PNT45239.1| hypothetical protein POPTR_003G126100v3 [Populus ... 182 1e-55 ref|XP_002303583.2| glutathione peroxidase family protein [Popul... 182 1e-55 >ref|XP_012854299.1| PREDICTED: probable phospholipid hydroperoxide glutathione peroxidase [Erythranthe guttata] gb|EYU23486.1| hypothetical protein MIMGU_mgv1a015049mg [Erythranthe guttata] Length = 169 Score = 194 bits (492), Expect = 5e-61 Identities = 90/99 (90%), Positives = 96/99 (96%) Frame = -2 Query: 385 GLEILAFPCNQFGSQEPGTIEEIQNFVCTRFKAEYPVFDKVEVNGPNTAPIYKYMKSVKG 206 GLEILAFPCNQFGSQEPGT+EEIQ FVCTRFKAEYPVFDKV+VNG + APIYKYMKS+KG Sbjct: 64 GLEILAFPCNQFGSQEPGTMEEIQEFVCTRFKAEYPVFDKVDVNGSSAAPIYKYMKSIKG 123 Query: 205 SLFGDNIKWNFSKFLVDKEGQIVDRYAPTTSPLSIEKDI 89 SLFGDNIKWNFSKFLVDKEGQ+VDRYAPTT+PLSIEKDI Sbjct: 124 SLFGDNIKWNFSKFLVDKEGQVVDRYAPTTTPLSIEKDI 162 >ref|XP_011080969.1| probable phospholipid hydroperoxide glutathione peroxidase [Sesamum indicum] Length = 169 Score = 192 bits (488), Expect = 2e-60 Identities = 91/99 (91%), Positives = 94/99 (94%) Frame = -2 Query: 385 GLEILAFPCNQFGSQEPGTIEEIQNFVCTRFKAEYPVFDKVEVNGPNTAPIYKYMKSVKG 206 GLEILAFPCNQFGSQEPGT EEIQ FVCTRFKAEYPVFDKVEVNG N APIYKYMKSVKG Sbjct: 64 GLEILAFPCNQFGSQEPGTNEEIQEFVCTRFKAEYPVFDKVEVNGDNAAPIYKYMKSVKG 123 Query: 205 SLFGDNIKWNFSKFLVDKEGQIVDRYAPTTSPLSIEKDI 89 LFGDNIKWNFSKFLV+KEG++VDRYAPTTSPLSIEKDI Sbjct: 124 GLFGDNIKWNFSKFLVNKEGEVVDRYAPTTSPLSIEKDI 162 >emb|CAJ43709.1| glutathion peroxidase [Plantago major] Length = 168 Score = 184 bits (466), Expect = 4e-57 Identities = 84/99 (84%), Positives = 92/99 (92%) Frame = -2 Query: 385 GLEILAFPCNQFGSQEPGTIEEIQNFVCTRFKAEYPVFDKVEVNGPNTAPIYKYMKSVKG 206 GLEILAFPCNQFGSQEPG+ EEIQNFVCTRFKAEYP+FDKV+VNG APIYK++KS KG Sbjct: 63 GLEILAFPCNQFGSQEPGSNEEIQNFVCTRFKAEYPIFDKVDVNGATAAPIYKFLKSAKG 122 Query: 205 SLFGDNIKWNFSKFLVDKEGQIVDRYAPTTSPLSIEKDI 89 LFGD IKWNFSKFLVDKEG++VDRYAPTTSPLSIEKD+ Sbjct: 123 GLFGDGIKWNFSKFLVDKEGKVVDRYAPTTSPLSIEKDV 161 >gb|KZV16091.1| putative phospholipid hydroperoxide glutathione peroxidase [Dorcoceras hygrometricum] Length = 169 Score = 183 bits (465), Expect = 6e-57 Identities = 83/99 (83%), Positives = 91/99 (91%) Frame = -2 Query: 385 GLEILAFPCNQFGSQEPGTIEEIQNFVCTRFKAEYPVFDKVEVNGPNTAPIYKYMKSVKG 206 GLEILAFPCNQFGSQEPG+ E+IQ F CTRFKAEYP+FDK+EVNG N APIYKY+KS KG Sbjct: 64 GLEILAFPCNQFGSQEPGSNEQIQEFACTRFKAEYPIFDKIEVNGSNAAPIYKYLKSAKG 123 Query: 205 SLFGDNIKWNFSKFLVDKEGQIVDRYAPTTSPLSIEKDI 89 LFGD+IKWNFSKFL+DKEG +VDRYAPTTSPLSIEKDI Sbjct: 124 GLFGDSIKWNFSKFLIDKEGHVVDRYAPTTSPLSIEKDI 162 >gb|PIN11872.1| Glutathione peroxidase [Handroanthus impetiginosus] gb|PIN22773.1| Glutathione peroxidase [Handroanthus impetiginosus] Length = 239 Score = 186 bits (471), Expect = 6e-57 Identities = 83/99 (83%), Positives = 92/99 (92%) Frame = -2 Query: 385 GLEILAFPCNQFGSQEPGTIEEIQNFVCTRFKAEYPVFDKVEVNGPNTAPIYKYMKSVKG 206 GLEILAFPCNQFGSQEPGT E+IQ F CTRFKAEYP+FDK+EVNGPN AP+Y Y+KS KG Sbjct: 134 GLEILAFPCNQFGSQEPGTNEQIQEFACTRFKAEYPIFDKIEVNGPNAAPLYNYLKSAKG 193 Query: 205 SLFGDNIKWNFSKFLVDKEGQIVDRYAPTTSPLSIEKDI 89 LFGDNIKWNFSKFLVDKEG++VDRYAPTTSP+SIEKD+ Sbjct: 194 GLFGDNIKWNFSKFLVDKEGRVVDRYAPTTSPVSIEKDM 232 >ref|XP_022846194.1| probable phospholipid hydroperoxide glutathione peroxidase, partial [Olea europaea var. sylvestris] Length = 149 Score = 182 bits (462), Expect = 9e-57 Identities = 84/99 (84%), Positives = 92/99 (92%) Frame = -2 Query: 385 GLEILAFPCNQFGSQEPGTIEEIQNFVCTRFKAEYPVFDKVEVNGPNTAPIYKYMKSVKG 206 GLEILAFPCNQFGSQEPGT EEI+ FVCTRFKAEYPVFDKV+VNG N +PIYKY+KS KG Sbjct: 43 GLEILAFPCNQFGSQEPGTNEEIREFVCTRFKAEYPVFDKVDVNGSNASPIYKYLKSSKG 102 Query: 205 SLFGDNIKWNFSKFLVDKEGQIVDRYAPTTSPLSIEKDI 89 +FGD+IKWNFSKFLVDK+G +VDRYAPTTSPLSIEKDI Sbjct: 103 GIFGDSIKWNFSKFLVDKDGHVVDRYAPTTSPLSIEKDI 141 >ref|XP_022845507.1| probable phospholipid hydroperoxide glutathione peroxidase [Olea europaea var. sylvestris] Length = 167 Score = 182 bits (462), Expect = 2e-56 Identities = 84/99 (84%), Positives = 92/99 (92%) Frame = -2 Query: 385 GLEILAFPCNQFGSQEPGTIEEIQNFVCTRFKAEYPVFDKVEVNGPNTAPIYKYMKSVKG 206 GLEILAFPCNQFGSQEPGT EEI+ FVCTRFKAEYPVFDKV+VNG N +PIYKY+KS KG Sbjct: 61 GLEILAFPCNQFGSQEPGTNEEIREFVCTRFKAEYPVFDKVDVNGSNASPIYKYLKSSKG 120 Query: 205 SLFGDNIKWNFSKFLVDKEGQIVDRYAPTTSPLSIEKDI 89 +FGD+IKWNFSKFLVDK+G +VDRYAPTTSPLSIEKDI Sbjct: 121 GIFGDSIKWNFSKFLVDKDGHVVDRYAPTTSPLSIEKDI 159 >ref|XP_003630521.2| phospholipid hydroperoxide glutathione peroxidase [Medicago truncatula] gb|AET04997.2| phospholipid hydroperoxide glutathione peroxidase [Medicago truncatula] Length = 167 Score = 182 bits (461), Expect = 2e-56 Identities = 83/99 (83%), Positives = 91/99 (91%) Frame = -2 Query: 385 GLEILAFPCNQFGSQEPGTIEEIQNFVCTRFKAEYPVFDKVEVNGPNTAPIYKYMKSVKG 206 GLEILAFPCNQFG+QEPG++EEIQNFVCTRFKAE+PVFDKV+VNG APIYKY+KS KG Sbjct: 63 GLEILAFPCNQFGAQEPGSVEEIQNFVCTRFKAEFPVFDKVDVNGATAAPIYKYLKSSKG 122 Query: 205 SLFGDNIKWNFSKFLVDKEGQIVDRYAPTTSPLSIEKDI 89 LFGD IKWNFSKFLVDK G +VDRYAPTTSPLSIEKD+ Sbjct: 123 GLFGDGIKWNFSKFLVDKNGNVVDRYAPTTSPLSIEKDL 161 >ref|XP_020217472.1| probable phospholipid hydroperoxide glutathione peroxidase [Cajanus cajan] Length = 227 Score = 184 bits (466), Expect = 2e-56 Identities = 84/99 (84%), Positives = 93/99 (93%) Frame = -2 Query: 385 GLEILAFPCNQFGSQEPGTIEEIQNFVCTRFKAEYPVFDKVEVNGPNTAPIYKYMKSVKG 206 GLEILAFPCNQFG+QEPG+ E+IQ FVCTRFKAE+PVFDKV+VNG NTAP+YKY+KS KG Sbjct: 123 GLEILAFPCNQFGAQEPGSNEQIQEFVCTRFKAEFPVFDKVDVNGDNTAPLYKYLKSSKG 182 Query: 205 SLFGDNIKWNFSKFLVDKEGQIVDRYAPTTSPLSIEKDI 89 LFGDNIKWNFSKFLVDKEG +VDRYAPTTSPLSIEKD+ Sbjct: 183 GLFGDNIKWNFSKFLVDKEGNVVDRYAPTTSPLSIEKDL 221 >ref|NP_001105091.1| GP protein [Zea mays] gb|AAM88847.2|AF520911_1 putative glutathione peroxidase [Zea mays] Length = 168 Score = 181 bits (460), Expect = 3e-56 Identities = 84/99 (84%), Positives = 90/99 (90%) Frame = -2 Query: 385 GLEILAFPCNQFGSQEPGTIEEIQNFVCTRFKAEYPVFDKVEVNGPNTAPIYKYMKSVKG 206 G EILAFPCNQFG QEPGT EEI F CTRFKAEYP+FDKV+VNG NTAPIYK++KS KG Sbjct: 63 GFEILAFPCNQFGGQEPGTNEEIVQFACTRFKAEYPIFDKVDVNGDNTAPIYKFLKSSKG 122 Query: 205 SLFGDNIKWNFSKFLVDKEGQIVDRYAPTTSPLSIEKDI 89 SLFGDNIKWNFSKFLVDKEG +V+RYAPTTSPLSIEKDI Sbjct: 123 SLFGDNIKWNFSKFLVDKEGHVVERYAPTTSPLSIEKDI 161 >gb|PON84601.1| Glutathione peroxidase [Trema orientalis] Length = 168 Score = 181 bits (459), Expect = 5e-56 Identities = 83/99 (83%), Positives = 92/99 (92%) Frame = -2 Query: 385 GLEILAFPCNQFGSQEPGTIEEIQNFVCTRFKAEYPVFDKVEVNGPNTAPIYKYMKSVKG 206 GLEILAFPCNQFG+QEPG+ EEI F CTRFKAEYP+FDKV+VNG N APIYKY+KS KG Sbjct: 63 GLEILAFPCNQFGAQEPGSNEEIVEFACTRFKAEYPIFDKVDVNGDNAAPIYKYLKSSKG 122 Query: 205 SLFGDNIKWNFSKFLVDKEGQIVDRYAPTTSPLSIEKDI 89 SLFGD+IKWNFSKFLVDKEG++VDRYAPTTSPLSIEKD+ Sbjct: 123 SLFGDSIKWNFSKFLVDKEGKVVDRYAPTTSPLSIEKDV 161 >gb|APZ73851.1| glutathione peroxidase [Populus euphratica] gb|APZ73852.1| glutathione peroxidase [Populus euphratica] gb|APZ73853.1| glutathione peroxidase [Populus euphratica] gb|APZ73854.1| glutathione peroxidase [Populus euphratica] gb|APZ73855.1| glutathione peroxidase [Populus euphratica] gb|APZ73856.1| glutathione peroxidase [Populus euphratica] gb|APZ73857.1| glutathione peroxidase [Populus euphratica] gb|APZ73858.1| glutathione peroxidase [Populus euphratica] gb|APZ73859.1| glutathione peroxidase [Populus euphratica] gb|APZ73860.1| glutathione peroxidase [Populus euphratica] gb|APZ73861.1| glutathione peroxidase [Populus euphratica] gb|APZ73862.1| glutathione peroxidase [Populus euphratica] gb|APZ73863.1| glutathione peroxidase [Populus euphratica] gb|APZ73864.1| glutathione peroxidase [Populus euphratica] gb|APZ73865.1| glutathione peroxidase [Populus euphratica] gb|APZ73866.1| glutathione peroxidase [Populus euphratica] gb|APZ73867.1| glutathione peroxidase [Populus euphratica] gb|APZ73868.1| glutathione peroxidase [Populus euphratica] gb|APZ73869.1| glutathione peroxidase [Populus euphratica] gb|APZ73870.1| glutathione peroxidase [Populus euphratica] gb|APZ73871.1| glutathione peroxidase [Populus euphratica] gb|APZ73872.1| glutathione peroxidase [Populus euphratica] gb|APZ73873.1| glutathione peroxidase [Populus euphratica] gb|APZ73874.1| glutathione peroxidase [Populus euphratica] gb|APZ73875.1| glutathione peroxidase [Populus euphratica] gb|APZ73876.1| glutathione peroxidase [Populus euphratica] gb|APZ73877.1| glutathione peroxidase [Populus euphratica] gb|APZ73878.1| glutathione peroxidase [Populus euphratica] gb|APZ73879.1| glutathione peroxidase [Populus euphratica] gb|APZ73880.1| glutathione peroxidase [Populus euphratica] gb|APZ73881.1| glutathione peroxidase [Populus euphratica] gb|APZ73882.1| glutathione peroxidase [Populus euphratica] gb|APZ73883.1| glutathione peroxidase [Populus euphratica] gb|APZ73884.1| glutathione peroxidase [Populus euphratica] gb|APZ73885.1| glutathione peroxidase [Populus euphratica] gb|APZ73886.1| glutathione peroxidase [Populus euphratica] gb|APZ73887.1| glutathione peroxidase [Populus euphratica] gb|APZ73888.1| glutathione peroxidase [Populus euphratica] gb|APZ73889.1| glutathione peroxidase [Populus euphratica] gb|APZ73890.1| glutathione peroxidase [Populus euphratica] gb|APZ73891.1| glutathione peroxidase [Populus euphratica] gb|APZ73892.1| glutathione peroxidase [Populus euphratica] gb|APZ73893.1| glutathione peroxidase [Populus euphratica] gb|APZ73894.1| glutathione peroxidase [Populus euphratica] gb|APZ73895.1| glutathione peroxidase [Populus euphratica] gb|APZ73896.1| glutathione peroxidase [Populus euphratica] gb|APZ73897.1| glutathione peroxidase [Populus euphratica] gb|APZ73898.1| glutathione peroxidase [Populus euphratica] gb|APZ73899.1| glutathione peroxidase [Populus euphratica] gb|APZ73900.1| glutathione peroxidase [Populus euphratica] gb|APZ73901.1| glutathione peroxidase [Populus euphratica] gb|APZ73902.1| glutathione peroxidase [Populus euphratica] gb|APZ73903.1| glutathione peroxidase [Populus euphratica] gb|APZ73904.1| glutathione peroxidase [Populus euphratica] gb|APZ73905.1| glutathione peroxidase [Populus euphratica] gb|APZ73906.1| glutathione peroxidase [Populus euphratica] gb|APZ73907.1| glutathione peroxidase [Populus euphratica] gb|APZ73908.1| glutathione peroxidase [Populus euphratica] gb|APZ73909.1| glutathione peroxidase [Populus euphratica] gb|APZ73910.1| glutathione peroxidase [Populus euphratica] gb|APZ73911.1| glutathione peroxidase [Populus euphratica] gb|APZ73912.1| glutathione peroxidase [Populus euphratica] gb|APZ73913.1| glutathione peroxidase [Populus euphratica] gb|APZ73914.1| glutathione peroxidase [Populus euphratica] gb|APZ73915.1| glutathione peroxidase [Populus euphratica] gb|APZ73916.1| glutathione peroxidase [Populus euphratica] gb|APZ73917.1| glutathione peroxidase [Populus euphratica] gb|APZ73918.1| glutathione peroxidase [Populus euphratica] gb|APZ73919.1| glutathione peroxidase [Populus euphratica] gb|APZ73920.1| glutathione peroxidase [Populus euphratica] gb|APZ73921.1| glutathione peroxidase [Populus euphratica] gb|APZ73922.1| glutathione peroxidase [Populus euphratica] gb|APZ73923.1| glutathione peroxidase [Populus euphratica] gb|APZ73924.1| glutathione peroxidase [Populus euphratica] gb|APZ73925.1| glutathione peroxidase [Populus euphratica] gb|APZ73926.1| glutathione peroxidase [Populus euphratica] gb|APZ73927.1| glutathione peroxidase [Populus euphratica] gb|APZ73928.1| glutathione peroxidase [Populus euphratica] gb|APZ73929.1| glutathione peroxidase [Populus euphratica] gb|APZ73930.1| glutathione peroxidase [Populus euphratica] gb|APZ73931.1| glutathione peroxidase [Populus euphratica] gb|APZ73932.1| glutathione peroxidase [Populus euphratica] gb|APZ73933.1| glutathione peroxidase [Populus euphratica] gb|APZ73934.1| glutathione peroxidase [Populus euphratica] gb|APZ73935.1| glutathione peroxidase [Populus euphratica] gb|APZ73936.1| glutathione peroxidase [Populus euphratica] gb|APZ73937.1| glutathione peroxidase [Populus euphratica] gb|APZ73938.1| glutathione peroxidase [Populus euphratica] gb|APZ73939.1| glutathione peroxidase [Populus euphratica] gb|APZ73940.1| glutathione peroxidase [Populus euphratica] Length = 168 Score = 181 bits (459), Expect = 5e-56 Identities = 83/99 (83%), Positives = 91/99 (91%) Frame = -2 Query: 385 GLEILAFPCNQFGSQEPGTIEEIQNFVCTRFKAEYPVFDKVEVNGPNTAPIYKYMKSVKG 206 GLEILAFPCNQFGSQEPG+ EEI F CTRFKAEYP+FDKVEVNG N APIYKY+KS KG Sbjct: 63 GLEILAFPCNQFGSQEPGSSEEIVEFACTRFKAEYPIFDKVEVNGNNAAPIYKYLKSSKG 122 Query: 205 SLFGDNIKWNFSKFLVDKEGQIVDRYAPTTSPLSIEKDI 89 LFGDNIKWNFSKFLVDK+G++VDRYAPTTSPLSIEK++ Sbjct: 123 GLFGDNIKWNFSKFLVDKDGKVVDRYAPTTSPLSIEKEV 161 >ref|XP_011072526.1| probable phospholipid hydroperoxide glutathione peroxidase isoform X2 [Sesamum indicum] Length = 169 Score = 181 bits (459), Expect = 5e-56 Identities = 83/99 (83%), Positives = 91/99 (91%) Frame = -2 Query: 385 GLEILAFPCNQFGSQEPGTIEEIQNFVCTRFKAEYPVFDKVEVNGPNTAPIYKYMKSVKG 206 GLEILAFPCNQFGSQEPG+ E+I F CTRFKAEYP+FDKVEVNG N AP+YKY+KS KG Sbjct: 64 GLEILAFPCNQFGSQEPGSNEQILEFACTRFKAEYPIFDKVEVNGSNAAPLYKYLKSAKG 123 Query: 205 SLFGDNIKWNFSKFLVDKEGQIVDRYAPTTSPLSIEKDI 89 LFGD+IKWNFSKFLVDKEG++VDRYAPTTSPLSIEKDI Sbjct: 124 GLFGDSIKWNFSKFLVDKEGRVVDRYAPTTSPLSIEKDI 162 >dbj|GAV57939.1| GSHPx domain-containing protein [Cephalotus follicularis] Length = 238 Score = 183 bits (465), Expect = 5e-56 Identities = 85/99 (85%), Positives = 91/99 (91%) Frame = -2 Query: 385 GLEILAFPCNQFGSQEPGTIEEIQNFVCTRFKAEYPVFDKVEVNGPNTAPIYKYMKSVKG 206 GLEILAFPCNQFGSQEPG+ EEI NF CTRFKAEYP+FDKV+VNG N APIYK++K KG Sbjct: 133 GLEILAFPCNQFGSQEPGSNEEIVNFACTRFKAEYPIFDKVDVNGSNAAPIYKFLKKSKG 192 Query: 205 SLFGDNIKWNFSKFLVDKEGQIVDRYAPTTSPLSIEKDI 89 SLFGDNIKWNFSKFLVDKEG +VDRYAPTTSPLSIEKDI Sbjct: 193 SLFGDNIKWNFSKFLVDKEGHVVDRYAPTTSPLSIEKDI 231 >emb|CDP09749.1| unnamed protein product [Coffea canephora] Length = 169 Score = 181 bits (458), Expect = 7e-56 Identities = 82/99 (82%), Positives = 91/99 (91%) Frame = -2 Query: 385 GLEILAFPCNQFGSQEPGTIEEIQNFVCTRFKAEYPVFDKVEVNGPNTAPIYKYMKSVKG 206 GLEILAFPCNQFGSQEPGT EEIQ F CTRFKAEYP+FDKV+VNG N AP+YK++KS KG Sbjct: 64 GLEILAFPCNQFGSQEPGTNEEIQQFACTRFKAEYPIFDKVDVNGSNAAPLYKFLKSSKG 123 Query: 205 SLFGDNIKWNFSKFLVDKEGQIVDRYAPTTSPLSIEKDI 89 LFGD+IKWNFSKFLVDKEG +VDRYAPTTSPLSIE+D+ Sbjct: 124 GLFGDSIKWNFSKFLVDKEGHVVDRYAPTTSPLSIEEDV 162 >gb|AFA36624.1| glutathione peroxidase-like protein, partial [Lolium perenne] Length = 109 Score = 178 bits (452), Expect = 8e-56 Identities = 81/99 (81%), Positives = 90/99 (90%) Frame = -2 Query: 385 GLEILAFPCNQFGSQEPGTIEEIQNFVCTRFKAEYPVFDKVEVNGPNTAPIYKYMKSVKG 206 G EILAFPCNQFG QEPGT EEI F CTRFKAEYP+FDKV+VNG N APIYK++K+ KG Sbjct: 4 GFEILAFPCNQFGGQEPGTNEEIVQFACTRFKAEYPIFDKVDVNGDNVAPIYKFLKTSKG 63 Query: 205 SLFGDNIKWNFSKFLVDKEGQIVDRYAPTTSPLSIEKDI 89 SLFGDNIKWNFSKFLVDKEG++VDRYAPTTSPL+IEKD+ Sbjct: 64 SLFGDNIKWNFSKFLVDKEGRVVDRYAPTTSPLNIEKDL 102 >gb|KQL30844.1| hypothetical protein SETIT_018223mg [Setaria italica] Length = 168 Score = 180 bits (457), Expect = 9e-56 Identities = 83/99 (83%), Positives = 91/99 (91%) Frame = -2 Query: 385 GLEILAFPCNQFGSQEPGTIEEIQNFVCTRFKAEYPVFDKVEVNGPNTAPIYKYMKSVKG 206 G EILAFPCNQFG QEPGT EEI F CTRFKAEYP+FDKV+VNG NTAPIYK++KS KG Sbjct: 63 GFEILAFPCNQFGGQEPGTNEEIVQFACTRFKAEYPIFDKVDVNGDNTAPIYKFLKSSKG 122 Query: 205 SLFGDNIKWNFSKFLVDKEGQIVDRYAPTTSPLSIEKDI 89 SLFG+NIKWNFSKFLVDKEG++V+RYAPTTSPLSIEKDI Sbjct: 123 SLFGENIKWNFSKFLVDKEGRVVERYAPTTSPLSIEKDI 161 >gb|AFP99878.1| glutathione peroxidase, partial [Medicago sativa] Length = 223 Score = 182 bits (461), Expect = 1e-55 Identities = 83/99 (83%), Positives = 91/99 (91%) Frame = -2 Query: 385 GLEILAFPCNQFGSQEPGTIEEIQNFVCTRFKAEYPVFDKVEVNGPNTAPIYKYMKSVKG 206 GLEILAFPCNQFG+QEPG++EEIQNFVCTRFKAE+PVFDKV+VNG APIYKY+KS KG Sbjct: 119 GLEILAFPCNQFGAQEPGSVEEIQNFVCTRFKAEFPVFDKVDVNGATAAPIYKYLKSSKG 178 Query: 205 SLFGDNIKWNFSKFLVDKEGQIVDRYAPTTSPLSIEKDI 89 LFGD IKWNFSKFLVDK G +VDRYAPTTSPLSIEKD+ Sbjct: 179 GLFGDGIKWNFSKFLVDKNGNVVDRYAPTTSPLSIEKDL 217 >gb|PNT45239.1| hypothetical protein POPTR_003G126100v3 [Populus trichocarpa] Length = 238 Score = 182 bits (462), Expect = 1e-55 Identities = 84/99 (84%), Positives = 91/99 (91%) Frame = -2 Query: 385 GLEILAFPCNQFGSQEPGTIEEIQNFVCTRFKAEYPVFDKVEVNGPNTAPIYKYMKSVKG 206 GLEILAFPCNQFGSQEPG+ EEI F CTRFKAEYP+FDKVEVNG N APIYKY+KS KG Sbjct: 133 GLEILAFPCNQFGSQEPGSSEEIVEFACTRFKAEYPIFDKVEVNGNNAAPIYKYLKSSKG 192 Query: 205 SLFGDNIKWNFSKFLVDKEGQIVDRYAPTTSPLSIEKDI 89 LFGDNIKWNFSKFLVDKEG++VDRYAPTTSPLSIEK++ Sbjct: 193 GLFGDNIKWNFSKFLVDKEGKVVDRYAPTTSPLSIEKEV 231 >ref|XP_002303583.2| glutathione peroxidase family protein [Populus trichocarpa] gb|ABK94488.1| unknown [Populus trichocarpa] Length = 238 Score = 182 bits (462), Expect = 1e-55 Identities = 84/99 (84%), Positives = 91/99 (91%) Frame = -2 Query: 385 GLEILAFPCNQFGSQEPGTIEEIQNFVCTRFKAEYPVFDKVEVNGPNTAPIYKYMKSVKG 206 GLEILAFPCNQFGSQEPG+ EEI F CTRFKAEYP+FDKVEVNG N APIYKY+KS KG Sbjct: 133 GLEILAFPCNQFGSQEPGSSEEIVEFACTRFKAEYPIFDKVEVNGNNAAPIYKYLKSSKG 192 Query: 205 SLFGDNIKWNFSKFLVDKEGQIVDRYAPTTSPLSIEKDI 89 LFGDNIKWNFSKFLVDKEG++VDRYAPTTSPLSIEK++ Sbjct: 193 GLFGDNIKWNFSKFLVDKEGKVVDRYAPTTSPLSIEKEV 231