BLASTX nr result
ID: Rehmannia31_contig00001062
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00001062 (401 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012834629.1| PREDICTED: thioredoxin F1, chloroplastic-lik... 131 3e-36 gb|PIN23221.1| Thioredoxin [Handroanthus impetiginosus] 125 1e-33 ref|XP_011077155.1| thioredoxin F1, chloroplastic-like [Sesamum ... 124 1e-33 ref|XP_020220124.1| thioredoxin F-type, chloroplastic-like [Caja... 124 3e-33 gb|OIW20744.1| hypothetical protein TanjilG_21809 [Lupinus angus... 122 4e-33 ref|XP_007139716.1| hypothetical protein PHAVU_008G053300g [Phas... 123 5e-33 ref|XP_014523208.1| thioredoxin F-type, chloroplastic [Vigna rad... 123 7e-33 ref|XP_017415969.1| PREDICTED: thioredoxin F-type, chloroplastic... 122 9e-33 gb|KOM37009.1| hypothetical protein LR48_Vigan03g039000, partial... 122 1e-32 ref|XP_010451256.1| PREDICTED: thioredoxin F1, chloroplastic-lik... 119 1e-32 gb|PKI66913.1| hypothetical protein CRG98_012676 [Punica granatum] 121 2e-32 ref|XP_019431639.1| PREDICTED: thioredoxin F-type, chloroplastic... 122 2e-32 gb|PON89098.1| Thioredoxin [Trema orientalis] 122 2e-32 ref|NP_186922.1| thioredoxin F-type 1 [Arabidopsis thaliana] >gi... 121 3e-32 ref|XP_006298548.2| thioredoxin F1, chloroplastic [Capsella rube... 121 4e-32 gb|PON59126.1| Thioredoxin [Parasponia andersonii] 121 4e-32 ref|XP_006345775.2| PREDICTED: thioredoxin F1, chloroplastic-lik... 121 4e-32 ref|XP_004239649.1| PREDICTED: thioredoxin F1, chloroplastic-lik... 121 4e-32 ref|XP_015875761.1| PREDICTED: thioredoxin F1, chloroplastic-lik... 121 4e-32 gb|OWM86151.1| hypothetical protein CDL15_Pgr010975 [Punica gran... 121 5e-32 >ref|XP_012834629.1| PREDICTED: thioredoxin F1, chloroplastic-like [Erythranthe guttata] Length = 175 Score = 131 bits (330), Expect = 3e-36 Identities = 63/71 (88%), Positives = 71/71 (100%) Frame = -3 Query: 399 MAPKFQKLSEKYDDVIFLKLDCNHENRPLAKELGIKVVPTFKILKDNKIVKEVTGAKMDD 220 MAPK+Q+LSEKYDDV+FLKLDCN++NRPLAKELG+KVVPTFKILKD+KIVKEVTGAK+DD Sbjct: 105 MAPKYQELSEKYDDVVFLKLDCNNDNRPLAKELGLKVVPTFKILKDSKIVKEVTGAKLDD 164 Query: 219 LVVAIENARSI 187 LVVAIENARSI Sbjct: 165 LVVAIENARSI 175 >gb|PIN23221.1| Thioredoxin [Handroanthus impetiginosus] Length = 175 Score = 125 bits (313), Expect = 1e-33 Identities = 62/70 (88%), Positives = 65/70 (92%) Frame = -3 Query: 399 MAPKFQKLSEKYDDVIFLKLDCNHENRPLAKELGIKVVPTFKILKDNKIVKEVTGAKMDD 220 MAPKFQ+LSEKY DV+FLKLDCN ENRPLAKELGIKVVPTFKILKD+KIVKEVTGAK DD Sbjct: 105 MAPKFQQLSEKYKDVVFLKLDCNQENRPLAKELGIKVVPTFKILKDSKIVKEVTGAKFDD 164 Query: 219 LVVAIENARS 190 LV AIE ARS Sbjct: 165 LVFAIETARS 174 >ref|XP_011077155.1| thioredoxin F1, chloroplastic-like [Sesamum indicum] Length = 175 Score = 124 bits (312), Expect = 1e-33 Identities = 61/70 (87%), Positives = 65/70 (92%) Frame = -3 Query: 399 MAPKFQKLSEKYDDVIFLKLDCNHENRPLAKELGIKVVPTFKILKDNKIVKEVTGAKMDD 220 MAPK+Q+LSEKY DVIFLKLDCN EN+PLAKELGIKVVPTFKILKDNKI+KEVTGAK DD Sbjct: 105 MAPKYQQLSEKYHDVIFLKLDCNQENKPLAKELGIKVVPTFKILKDNKIIKEVTGAKYDD 164 Query: 219 LVVAIENARS 190 LV AIE ARS Sbjct: 165 LVAAIETARS 174 >ref|XP_020220124.1| thioredoxin F-type, chloroplastic-like [Cajanus cajan] gb|KYP64178.1| hypothetical protein KK1_018768 [Cajanus cajan] Length = 185 Score = 124 bits (311), Expect = 3e-33 Identities = 60/70 (85%), Positives = 66/70 (94%) Frame = -3 Query: 399 MAPKFQKLSEKYDDVIFLKLDCNHENRPLAKELGIKVVPTFKILKDNKIVKEVTGAKMDD 220 MAPKFQ+LSEKY DV+FLKLDCN +N+PLAKELGIKVVPTFKILKDNK+VKEVTGAK DD Sbjct: 115 MAPKFQELSEKYLDVVFLKLDCNQDNKPLAKELGIKVVPTFKILKDNKVVKEVTGAKYDD 174 Query: 219 LVVAIENARS 190 LVVAI+N RS Sbjct: 175 LVVAIDNVRS 184 >gb|OIW20744.1| hypothetical protein TanjilG_21809 [Lupinus angustifolius] Length = 130 Score = 122 bits (305), Expect = 4e-33 Identities = 59/70 (84%), Positives = 65/70 (92%) Frame = -3 Query: 399 MAPKFQKLSEKYDDVIFLKLDCNHENRPLAKELGIKVVPTFKILKDNKIVKEVTGAKMDD 220 +APKFQ+LSEKY DV+FLKLDCN ENRPLAKELGI+VVPTFKILKDNK+VKEVTGAK DD Sbjct: 60 IAPKFQELSEKYLDVVFLKLDCNQENRPLAKELGIRVVPTFKILKDNKVVKEVTGAKFDD 119 Query: 219 LVVAIENARS 190 LVVAI+ RS Sbjct: 120 LVVAIDTVRS 129 >ref|XP_007139716.1| hypothetical protein PHAVU_008G053300g [Phaseolus vulgaris] gb|ESW11710.1| hypothetical protein PHAVU_008G053300g [Phaseolus vulgaris] Length = 181 Score = 123 bits (309), Expect = 5e-33 Identities = 58/69 (84%), Positives = 65/69 (94%) Frame = -3 Query: 399 MAPKFQKLSEKYDDVIFLKLDCNHENRPLAKELGIKVVPTFKILKDNKIVKEVTGAKMDD 220 MAPKFQ+LS+KY+DV+FLKLDCN +NRPLAKELGIKVVPTFKILKDNK+VKEVTGAK DD Sbjct: 111 MAPKFQELSKKYEDVVFLKLDCNQDNRPLAKELGIKVVPTFKILKDNKVVKEVTGAKFDD 170 Query: 219 LVVAIENAR 193 LV AI+N R Sbjct: 171 LVAAIDNVR 179 >ref|XP_014523208.1| thioredoxin F-type, chloroplastic [Vigna radiata var. radiata] Length = 181 Score = 123 bits (308), Expect = 7e-33 Identities = 58/69 (84%), Positives = 65/69 (94%) Frame = -3 Query: 399 MAPKFQKLSEKYDDVIFLKLDCNHENRPLAKELGIKVVPTFKILKDNKIVKEVTGAKMDD 220 MAPKFQ+LS+KY+DV+FLKLDCN +NRPLAKELGIKVVPTFKILKDNK+VKEVTGAK DD Sbjct: 111 MAPKFQELSKKYEDVVFLKLDCNQDNRPLAKELGIKVVPTFKILKDNKVVKEVTGAKYDD 170 Query: 219 LVVAIENAR 193 LV AI+N R Sbjct: 171 LVAAIDNVR 179 >ref|XP_017415969.1| PREDICTED: thioredoxin F-type, chloroplastic [Vigna angularis] dbj|BAT83515.1| hypothetical protein VIGAN_04067400 [Vigna angularis var. angularis] Length = 181 Score = 122 bits (307), Expect = 9e-33 Identities = 57/69 (82%), Positives = 65/69 (94%) Frame = -3 Query: 399 MAPKFQKLSEKYDDVIFLKLDCNHENRPLAKELGIKVVPTFKILKDNKIVKEVTGAKMDD 220 MAPKFQ+LS+KY+DV+FLKLDCN +NRPLAKELGIKVVPTFKILKDNK+VKEVTGAK DD Sbjct: 111 MAPKFQELSKKYEDVVFLKLDCNQDNRPLAKELGIKVVPTFKILKDNKVVKEVTGAKYDD 170 Query: 219 LVVAIENAR 193 L+ AI+N R Sbjct: 171 LIAAIDNVR 179 >gb|KOM37009.1| hypothetical protein LR48_Vigan03g039000, partial [Vigna angularis] Length = 188 Score = 122 bits (307), Expect = 1e-32 Identities = 57/69 (82%), Positives = 65/69 (94%) Frame = -3 Query: 399 MAPKFQKLSEKYDDVIFLKLDCNHENRPLAKELGIKVVPTFKILKDNKIVKEVTGAKMDD 220 MAPKFQ+LS+KY+DV+FLKLDCN +NRPLAKELGIKVVPTFKILKDNK+VKEVTGAK DD Sbjct: 118 MAPKFQELSKKYEDVVFLKLDCNQDNRPLAKELGIKVVPTFKILKDNKVVKEVTGAKYDD 177 Query: 219 LVVAIENAR 193 L+ AI+N R Sbjct: 178 LIAAIDNVR 186 >ref|XP_010451256.1| PREDICTED: thioredoxin F1, chloroplastic-like [Camelina sativa] Length = 93 Score = 119 bits (299), Expect = 1e-32 Identities = 57/70 (81%), Positives = 65/70 (92%) Frame = -3 Query: 399 MAPKFQKLSEKYDDVIFLKLDCNHENRPLAKELGIKVVPTFKILKDNKIVKEVTGAKMDD 220 +APK++ LSEKY+DV+FLKLDCN +NRPLAKELGI+VVPTFKILKDNK+VKEVTGAK DD Sbjct: 18 IAPKYKALSEKYEDVVFLKLDCNPDNRPLAKELGIRVVPTFKILKDNKVVKEVTGAKYDD 77 Query: 219 LVVAIENARS 190 LV AIE ARS Sbjct: 78 LVAAIETARS 87 >gb|PKI66913.1| hypothetical protein CRG98_012676 [Punica granatum] Length = 171 Score = 121 bits (304), Expect = 2e-32 Identities = 59/70 (84%), Positives = 63/70 (90%) Frame = -3 Query: 399 MAPKFQKLSEKYDDVIFLKLDCNHENRPLAKELGIKVVPTFKILKDNKIVKEVTGAKMDD 220 MAPKFQ LSEKY DV+FLKLDCNHENRPL KELGI+VVPTFKILKD+KIVKEVTGAK DD Sbjct: 101 MAPKFQNLSEKYLDVVFLKLDCNHENRPLVKELGIRVVPTFKILKDSKIVKEVTGAKFDD 160 Query: 219 LVVAIENARS 190 L +AIE RS Sbjct: 161 LALAIETVRS 170 >ref|XP_019431639.1| PREDICTED: thioredoxin F-type, chloroplastic-like [Lupinus angustifolius] ref|XP_019431640.1| PREDICTED: thioredoxin F-type, chloroplastic-like [Lupinus angustifolius] Length = 185 Score = 122 bits (305), Expect = 2e-32 Identities = 59/70 (84%), Positives = 65/70 (92%) Frame = -3 Query: 399 MAPKFQKLSEKYDDVIFLKLDCNHENRPLAKELGIKVVPTFKILKDNKIVKEVTGAKMDD 220 +APKFQ+LSEKY DV+FLKLDCN ENRPLAKELGI+VVPTFKILKDNK+VKEVTGAK DD Sbjct: 115 IAPKFQELSEKYLDVVFLKLDCNQENRPLAKELGIRVVPTFKILKDNKVVKEVTGAKFDD 174 Query: 219 LVVAIENARS 190 LVVAI+ RS Sbjct: 175 LVVAIDTVRS 184 >gb|PON89098.1| Thioredoxin [Trema orientalis] Length = 187 Score = 122 bits (305), Expect = 2e-32 Identities = 59/70 (84%), Positives = 66/70 (94%) Frame = -3 Query: 399 MAPKFQKLSEKYDDVIFLKLDCNHENRPLAKELGIKVVPTFKILKDNKIVKEVTGAKMDD 220 MAPKFQ+LSEKY DV+FLKLDCN +N+PLAKELGI+VVPTFKILKDNKIVKEVTGAK DD Sbjct: 117 MAPKFQELSEKYLDVVFLKLDCNQDNKPLAKELGIRVVPTFKILKDNKIVKEVTGAKFDD 176 Query: 219 LVVAIENARS 190 LVVAI++ RS Sbjct: 177 LVVAIDSVRS 186 >ref|NP_186922.1| thioredoxin F-type 1 [Arabidopsis thaliana] sp|Q9XFH8.2|TRXF1_ARATH RecName: Full=Thioredoxin F1, chloroplastic; Short=AtTrxf1; AltName: Full=Thioredoxin F2; Short=AtTrxf2; Flags: Precursor gb|AAF26987.1|AC018363_32 thioredoxin f1 [Arabidopsis thaliana] gb|AAL38832.1| putative thioredoxin f1 protein [Arabidopsis thaliana] gb|AAM20355.1| putative thioredoxin f1 protein [Arabidopsis thaliana] gb|AAM61345.1| thioredoxin f1 [Arabidopsis thaliana] gb|AEE73852.1| thioredoxin F-type 1 [Arabidopsis thaliana] gb|OAP02322.1| TRXF1 [Arabidopsis thaliana] Length = 178 Score = 121 bits (303), Expect = 3e-32 Identities = 58/70 (82%), Positives = 65/70 (92%) Frame = -3 Query: 399 MAPKFQKLSEKYDDVIFLKLDCNHENRPLAKELGIKVVPTFKILKDNKIVKEVTGAKMDD 220 +APK++ LSEKYDDV+FLKLDCN +NRPLAKELGI+VVPTFKILKDNK+VKEVTGAK DD Sbjct: 105 IAPKYKALSEKYDDVVFLKLDCNPDNRPLAKELGIRVVPTFKILKDNKVVKEVTGAKYDD 164 Query: 219 LVVAIENARS 190 LV AIE ARS Sbjct: 165 LVAAIETARS 174 >ref|XP_006298548.2| thioredoxin F1, chloroplastic [Capsella rubella] Length = 180 Score = 121 bits (303), Expect = 4e-32 Identities = 58/70 (82%), Positives = 65/70 (92%) Frame = -3 Query: 399 MAPKFQKLSEKYDDVIFLKLDCNHENRPLAKELGIKVVPTFKILKDNKIVKEVTGAKMDD 220 +APK++ LSEKYDDV+FLKLDCN +NRPLAKELGI+VVPTFKILKDNK+VKEVTGAK DD Sbjct: 106 IAPKYKALSEKYDDVVFLKLDCNPDNRPLAKELGIRVVPTFKILKDNKVVKEVTGAKYDD 165 Query: 219 LVVAIENARS 190 LV AIE ARS Sbjct: 166 LVAAIETARS 175 >gb|PON59126.1| Thioredoxin [Parasponia andersonii] Length = 193 Score = 121 bits (304), Expect = 4e-32 Identities = 59/70 (84%), Positives = 66/70 (94%) Frame = -3 Query: 399 MAPKFQKLSEKYDDVIFLKLDCNHENRPLAKELGIKVVPTFKILKDNKIVKEVTGAKMDD 220 +APKFQ+LSEKY DV+FLKLDCN +N+PLAKELGI+VVPTFKILKDNKIVKEVTGAK DD Sbjct: 123 IAPKFQELSEKYLDVVFLKLDCNQDNKPLAKELGIRVVPTFKILKDNKIVKEVTGAKFDD 182 Query: 219 LVVAIENARS 190 LVVAIE+ RS Sbjct: 183 LVVAIESVRS 192 >ref|XP_006345775.2| PREDICTED: thioredoxin F1, chloroplastic-like [Solanum tuberosum] Length = 182 Score = 121 bits (303), Expect = 4e-32 Identities = 58/70 (82%), Positives = 66/70 (94%) Frame = -3 Query: 399 MAPKFQKLSEKYDDVIFLKLDCNHENRPLAKELGIKVVPTFKILKDNKIVKEVTGAKMDD 220 +APKFQ+LS+KY+DV+FLKLDCN +NRPLAKELGIKVVPTFKILK+NKIVKEVTGAK+DD Sbjct: 112 IAPKFQELSKKYNDVVFLKLDCNQDNRPLAKELGIKVVPTFKILKNNKIVKEVTGAKLDD 171 Query: 219 LVVAIENARS 190 LV AIE RS Sbjct: 172 LVAAIEGVRS 181 >ref|XP_004239649.1| PREDICTED: thioredoxin F1, chloroplastic-like [Solanum lycopersicum] ref|XP_015076156.1| PREDICTED: thioredoxin F1, chloroplastic-like [Solanum pennellii] Length = 182 Score = 121 bits (303), Expect = 4e-32 Identities = 58/70 (82%), Positives = 66/70 (94%) Frame = -3 Query: 399 MAPKFQKLSEKYDDVIFLKLDCNHENRPLAKELGIKVVPTFKILKDNKIVKEVTGAKMDD 220 +APKFQ+LS+KY+DV+FLKLDCN +NRPLAKELGIKVVPTFKILK+NKIVKEVTGAK+DD Sbjct: 112 IAPKFQELSKKYNDVVFLKLDCNQDNRPLAKELGIKVVPTFKILKNNKIVKEVTGAKLDD 171 Query: 219 LVVAIENARS 190 LV AIE RS Sbjct: 172 LVAAIEGVRS 181 >ref|XP_015875761.1| PREDICTED: thioredoxin F1, chloroplastic-like [Ziziphus jujuba] Length = 183 Score = 121 bits (303), Expect = 4e-32 Identities = 57/70 (81%), Positives = 66/70 (94%) Frame = -3 Query: 399 MAPKFQKLSEKYDDVIFLKLDCNHENRPLAKELGIKVVPTFKILKDNKIVKEVTGAKMDD 220 M PKFQ+L++KYDDV+FLKLDCN +NRPLAKELGI+VVPTFKILKD+KIVKEVTGAK DD Sbjct: 113 MTPKFQELAQKYDDVVFLKLDCNQDNRPLAKELGIRVVPTFKILKDSKIVKEVTGAKFDD 172 Query: 219 LVVAIENARS 190 LVVAI++ RS Sbjct: 173 LVVAIDSVRS 182 >gb|OWM86151.1| hypothetical protein CDL15_Pgr010975 [Punica granatum] Length = 201 Score = 121 bits (304), Expect = 5e-32 Identities = 59/70 (84%), Positives = 63/70 (90%) Frame = -3 Query: 399 MAPKFQKLSEKYDDVIFLKLDCNHENRPLAKELGIKVVPTFKILKDNKIVKEVTGAKMDD 220 MAPKFQ LSEKY DV+FLKLDCNHENRPL KELGI+VVPTFKILKD+KIVKEVTGAK DD Sbjct: 131 MAPKFQNLSEKYLDVVFLKLDCNHENRPLVKELGIRVVPTFKILKDSKIVKEVTGAKFDD 190 Query: 219 LVVAIENARS 190 L +AIE RS Sbjct: 191 LALAIETVRS 200