BLASTX nr result
ID: Rehmannia31_contig00001019
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00001019 (434 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAU35078.1| hypothetical protein TSUD_70010, partial [Trifol... 73 4e-14 gb|KDP29844.1| hypothetical protein JCGZ_18419 [Jatropha curcas] 73 5e-14 gb|KRH27607.1| hypothetical protein GLYMA_11G003600 [Glycine max] 73 5e-14 gb|KJB73330.1| hypothetical protein B456_011G230200 [Gossypium r... 73 5e-14 ref|XP_021664435.1| 40S ribosomal protein S15a-like, partial [He... 73 5e-14 gb|KJB20169.1| hypothetical protein B456_003G136100 [Gossypium r... 73 6e-14 ref|XP_012466363.1| PREDICTED: 40S ribosomal protein S15a-like [... 73 7e-14 ref|XP_006379579.1| hypothetical protein POPTR_0008s05190g [Popu... 73 7e-14 ref|XP_018623974.1| PREDICTED: 40S ribosomal protein S15a isofor... 73 7e-14 ref|XP_009800352.1| PREDICTED: 40S ribosomal protein S15a isofor... 73 7e-14 ref|XP_020537957.1| 40S ribosomal protein S15a, partial [Jatroph... 73 8e-14 ref|XP_015159926.1| PREDICTED: 40S ribosomal protein S15a-like i... 73 9e-14 gb|POE81451.1| 40s ribosomal protein s15a-1 [Quercus suber] 73 9e-14 gb|OTG07567.1| putative ribosomal protein S8 [Helianthus annuus]... 73 9e-14 ref|XP_020551882.1| 40S ribosomal protein S15a-like [Sesamum ind... 73 9e-14 gb|KCW65516.1| hypothetical protein EUGRSUZ_G02917 [Eucalyptus g... 73 9e-14 ref|NP_001238311.1| uncharacterized protein LOC100527843 [Glycin... 73 9e-14 gb|PIN23962.1| 40S ribosomal protein S15/S22 [Handroanthus impet... 73 1e-13 ref|XP_019579061.1| PREDICTED: 40S ribosomal protein S15a-1, par... 73 1e-13 gb|KVI11987.1| Ribosomal protein S8 [Cynara cardunculus var. sco... 73 1e-13 >dbj|GAU35078.1| hypothetical protein TSUD_70010, partial [Trifolium subterraneum] gb|PNY02618.1| 40S ribosomal protein s15a-1-like, partial [Trifolium pratense] Length = 85 Score = 72.8 bits (177), Expect = 4e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 434 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 333 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 52 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 85 >gb|KDP29844.1| hypothetical protein JCGZ_18419 [Jatropha curcas] Length = 90 Score = 72.8 bits (177), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 434 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 333 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 57 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 90 >gb|KRH27607.1| hypothetical protein GLYMA_11G003600 [Glycine max] Length = 92 Score = 72.8 bits (177), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 434 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 333 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 59 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 92 >gb|KJB73330.1| hypothetical protein B456_011G230200 [Gossypium raimondii] Length = 93 Score = 72.8 bits (177), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 434 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 333 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 60 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 93 >ref|XP_021664435.1| 40S ribosomal protein S15a-like, partial [Hevea brasiliensis] Length = 94 Score = 72.8 bits (177), Expect = 5e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 434 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 333 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 61 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 94 >gb|KJB20169.1| hypothetical protein B456_003G136100 [Gossypium raimondii] Length = 98 Score = 72.8 bits (177), Expect = 6e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 434 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 333 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 65 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 98 >ref|XP_012466363.1| PREDICTED: 40S ribosomal protein S15a-like [Gossypium raimondii] gb|KJB84360.1| hypothetical protein B456_N020900 [Gossypium raimondii] Length = 105 Score = 72.8 bits (177), Expect = 7e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 434 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 333 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 72 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 105 >ref|XP_006379579.1| hypothetical protein POPTR_0008s05190g [Populus trichocarpa] gb|PNT22853.1| hypothetical protein POPTR_008G051900v3 [Populus trichocarpa] Length = 105 Score = 72.8 bits (177), Expect = 7e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 434 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 333 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 72 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 105 >ref|XP_018623974.1| PREDICTED: 40S ribosomal protein S15a isoform X2 [Nicotiana tomentosiformis] Length = 106 Score = 72.8 bits (177), Expect = 7e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 434 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 333 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 73 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 106 >ref|XP_009800352.1| PREDICTED: 40S ribosomal protein S15a isoform X2 [Nicotiana sylvestris] ref|XP_016478012.1| PREDICTED: 40S ribosomal protein S15a isoform X2 [Nicotiana tabacum] Length = 106 Score = 72.8 bits (177), Expect = 7e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 434 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 333 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 73 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 106 >ref|XP_020537957.1| 40S ribosomal protein S15a, partial [Jatropha curcas] Length = 112 Score = 72.8 bits (177), Expect = 8e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 434 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 333 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 79 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 112 >ref|XP_015159926.1| PREDICTED: 40S ribosomal protein S15a-like isoform X1 [Solanum tuberosum] ref|XP_015159927.1| PREDICTED: 40S ribosomal protein S15a-like isoform X2 [Solanum tuberosum] Length = 116 Score = 72.8 bits (177), Expect = 9e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 434 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 333 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 83 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 116 >gb|POE81451.1| 40s ribosomal protein s15a-1 [Quercus suber] Length = 117 Score = 72.8 bits (177), Expect = 9e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 434 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 333 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 84 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 117 >gb|OTG07567.1| putative ribosomal protein S8 [Helianthus annuus] gb|OTG18906.1| putative ribosomal protein S8 [Helianthus annuus] gb|OTG24217.1| putative ribosomal protein S8 [Helianthus annuus] Length = 117 Score = 72.8 bits (177), Expect = 9e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 434 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 333 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 84 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 117 >ref|XP_020551882.1| 40S ribosomal protein S15a-like [Sesamum indicum] Length = 117 Score = 72.8 bits (177), Expect = 9e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 434 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 333 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 84 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 117 >gb|KCW65516.1| hypothetical protein EUGRSUZ_G02917 [Eucalyptus grandis] Length = 117 Score = 72.8 bits (177), Expect = 9e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 434 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 333 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 84 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 117 >ref|NP_001238311.1| uncharacterized protein LOC100527843 [Glycine max] gb|ACU17035.1| unknown [Glycine max] Length = 117 Score = 72.8 bits (177), Expect = 9e-14 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 434 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 333 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 84 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 117 >gb|PIN23962.1| 40S ribosomal protein S15/S22 [Handroanthus impetiginosus] Length = 119 Score = 72.8 bits (177), Expect = 1e-13 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 434 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 333 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 86 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 119 >ref|XP_019579061.1| PREDICTED: 40S ribosomal protein S15a-1, partial [Rhinolophus sinicus] Length = 128 Score = 72.8 bits (177), Expect = 1e-13 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 434 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 333 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 95 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 128 >gb|KVI11987.1| Ribosomal protein S8 [Cynara cardunculus var. scolymus] Length = 129 Score = 72.8 bits (177), Expect = 1e-13 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -1 Query: 434 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 333 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY Sbjct: 96 RQFGYIVLTTSAGIMDHEEARRKNVGGKVLGFFY 129