BLASTX nr result
ID: Rehmannia31_contig00000688
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00000688 (370 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012858428.1| PREDICTED: superoxide dismutase [Fe], chloro... 54 5e-06 gb|PIN26917.1| Manganese superoxide dismutase [Handroanthus impe... 54 7e-06 >ref|XP_012858428.1| PREDICTED: superoxide dismutase [Fe], chloroplastic [Erythranthe guttata] gb|EYU20151.1| hypothetical protein MIMGU_mgv1a010591mg [Erythranthe guttata] Length = 307 Score = 54.3 bits (129), Expect = 5e-06 Identities = 28/56 (50%), Positives = 33/56 (58%) Frame = +1 Query: 1 PDYISTFMEKLVSWDAVNSRLXXXXXXXXXXXXXXXXXXTEYEDNQADLDAREMYL 168 PDY+STFMEKLVSWDAV++RL TE EDN + +A EMYL Sbjct: 242 PDYVSTFMEKLVSWDAVSARLEAAMARAAEREKEEEMKKTESEDNLTNSEAVEMYL 297 >gb|PIN26917.1| Manganese superoxide dismutase [Handroanthus impetiginosus] Length = 305 Score = 53.9 bits (128), Expect = 7e-06 Identities = 29/57 (50%), Positives = 35/57 (61%), Gaps = 1/57 (1%) Frame = +1 Query: 1 PDYISTFMEKLVSWDAVNSRLXXXXXXXXXXXXXXXXXXTEYE-DNQADLDAREMYL 168 PDYISTFM+KLVSWDAV+SRL TEYE +NQ + +A EMY+ Sbjct: 239 PDYISTFMKKLVSWDAVSSRLEAAKAQAAEREREEERRKTEYEGENQTESEAVEMYM 295