BLASTX nr result
ID: Rehmannia31_contig00000493
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00000493 (542 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011088833.1| pentatricopeptide repeat-containing protein ... 64 1e-08 >ref|XP_011088833.1| pentatricopeptide repeat-containing protein At5g25630 [Sesamum indicum] ref|XP_020549790.1| pentatricopeptide repeat-containing protein At5g25630 [Sesamum indicum] Length = 625 Score = 64.3 bits (155), Expect = 1e-08 Identities = 35/52 (67%), Positives = 38/52 (73%), Gaps = 5/52 (9%) Frame = -1 Query: 542 RTVLREAEF-SSDGFCST----KTTCRFGERAPVVSRRHFQGQVCVSGQFAP 402 R VLREAEF SS+ ST TCRFGERAP+VSRRHF Q+CVSG FAP Sbjct: 566 RMVLREAEFPSSESLRSTTKAMNLTCRFGERAPMVSRRHFHAQLCVSGPFAP 617