BLASTX nr result
ID: Rehmannia31_contig00000444
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00000444 (815 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010266430.1| PREDICTED: arabinogalactan peptide 20-like [... 71 3e-12 ref|XP_015889389.1| PREDICTED: arabinogalactan peptide 20-like [... 71 3e-12 ref|XP_024173844.1| arabinogalactan peptide 20-like [Rosa chinen... 71 3e-12 ref|XP_010109451.1| arabinogalactan peptide 20 [Morus notabilis]... 70 4e-12 ref|XP_015167694.1| PREDICTED: arabinogalactan peptide 16 [Solan... 70 4e-12 ref|XP_023528757.1| arabinogalactan peptide 16-like [Cucurbita p... 70 4e-12 ref|XP_022924337.1| arabinogalactan peptide 16-like [Cucurbita m... 70 5e-12 ref|XP_021653334.1| arabinogalactan peptide 20 [Hevea brasiliensis] 70 7e-12 ref|XP_004133836.1| PREDICTED: arabinogalactan peptide 20 [Cucum... 70 8e-12 ref|XP_022147463.1| arabinogalactan peptide 20-like [Momordica c... 70 8e-12 ref|XP_019234597.1| PREDICTED: arabinogalactan peptide 16-like [... 69 1e-11 ref|XP_021614001.1| arabinogalactan peptide 16-like [Manihot esc... 69 1e-11 gb|PPS17735.1| hypothetical protein GOBAR_AA02834 [Gossypium bar... 69 1e-11 gb|PIN26532.1| hypothetical protein CDL12_00702 [Handroanthus im... 69 1e-11 ref|XP_022770538.1| arabinogalactan peptide 20-like [Durio zibet... 69 1e-11 ref|XP_022759580.1| arabinogalactan peptide 20-like [Durio zibet... 69 1e-11 ref|XP_021280700.1| arabinogalactan peptide 20 [Herrania umbratica] 69 1e-11 gb|OMO64348.1| Arabinogalactan peptide, AGP [Corchorus capsulari... 69 1e-11 ref|XP_007051629.2| PREDICTED: arabinogalactan peptide 20 [Theob... 69 1e-11 ref|XP_016676730.1| PREDICTED: arabinogalactan peptide 20-like [... 69 1e-11 >ref|XP_010266430.1| PREDICTED: arabinogalactan peptide 20-like [Nelumbo nucifera] Length = 73 Score = 70.9 bits (172), Expect = 3e-12 Identities = 32/35 (91%), Positives = 35/35 (100%) Frame = +1 Query: 274 DGTSVDQGIAYILMLVALVLTYLIHPMDASSYNFF 378 DGTS+DQGIAY+LMLVALVLTYLIHP+DASSYNFF Sbjct: 39 DGTSIDQGIAYVLMLVALVLTYLIHPLDASSYNFF 73 >ref|XP_015889389.1| PREDICTED: arabinogalactan peptide 20-like [Ziziphus jujuba] Length = 76 Score = 70.9 bits (172), Expect = 3e-12 Identities = 32/35 (91%), Positives = 35/35 (100%) Frame = +1 Query: 274 DGTSVDQGIAYILMLVALVLTYLIHPMDASSYNFF 378 DGTS+DQGIAY+LMLVALVLTYLIHP+DASSYNFF Sbjct: 42 DGTSIDQGIAYVLMLVALVLTYLIHPLDASSYNFF 76 >ref|XP_024173844.1| arabinogalactan peptide 20-like [Rosa chinensis] gb|PRQ58388.1| putative arabinogalactan peptide, AGP [Rosa chinensis] Length = 83 Score = 70.9 bits (172), Expect = 3e-12 Identities = 32/35 (91%), Positives = 35/35 (100%) Frame = +1 Query: 274 DGTSVDQGIAYILMLVALVLTYLIHPMDASSYNFF 378 DGTS+DQGIAY+LMLVALVLTYLIHP+DASSYNFF Sbjct: 49 DGTSIDQGIAYVLMLVALVLTYLIHPLDASSYNFF 83 >ref|XP_010109451.1| arabinogalactan peptide 20 [Morus notabilis] gb|EXC22521.1| hypothetical protein L484_003071 [Morus notabilis] Length = 76 Score = 70.5 bits (171), Expect = 4e-12 Identities = 31/35 (88%), Positives = 35/35 (100%) Frame = +1 Query: 274 DGTSVDQGIAYILMLVALVLTYLIHPMDASSYNFF 378 DGTS+DQG+AY+LMLVALVLTYLIHP+DASSYNFF Sbjct: 42 DGTSIDQGVAYVLMLVALVLTYLIHPLDASSYNFF 76 >ref|XP_015167694.1| PREDICTED: arabinogalactan peptide 16 [Solanum tuberosum] ref|XP_015167698.1| PREDICTED: arabinogalactan peptide 16 [Solanum tuberosum] Length = 67 Score = 70.1 bits (170), Expect = 4e-12 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = +1 Query: 274 DGTSVDQGIAYILMLVALVLTYLIHPMDASSYNFF 378 DG SVDQGIAY+LMLVALVLTYLIHPMDASSYNFF Sbjct: 33 DGISVDQGIAYVLMLVALVLTYLIHPMDASSYNFF 67 >ref|XP_023528757.1| arabinogalactan peptide 16-like [Cucurbita pepo subsp. pepo] Length = 81 Score = 70.5 bits (171), Expect = 4e-12 Identities = 31/35 (88%), Positives = 35/35 (100%) Frame = +1 Query: 274 DGTSVDQGIAYILMLVALVLTYLIHPMDASSYNFF 378 DGTS+DQG+AY+LMLVALVLTYLIHP+DASSYNFF Sbjct: 45 DGTSIDQGVAYVLMLVALVLTYLIHPLDASSYNFF 79 >ref|XP_022924337.1| arabinogalactan peptide 16-like [Cucurbita moschata] Length = 83 Score = 70.5 bits (171), Expect = 5e-12 Identities = 31/35 (88%), Positives = 35/35 (100%) Frame = +1 Query: 274 DGTSVDQGIAYILMLVALVLTYLIHPMDASSYNFF 378 DGTS+DQG+AY+LMLVALVLTYLIHP+DASSYNFF Sbjct: 47 DGTSIDQGVAYVLMLVALVLTYLIHPLDASSYNFF 81 >ref|XP_021653334.1| arabinogalactan peptide 20 [Hevea brasiliensis] Length = 74 Score = 69.7 bits (169), Expect = 7e-12 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = +1 Query: 274 DGTSVDQGIAYILMLVALVLTYLIHPMDASSYNFF 378 DGTSVDQGIAY LMLVALVLTYLIHP+DASSYNFF Sbjct: 40 DGTSVDQGIAYALMLVALVLTYLIHPLDASSYNFF 74 >ref|XP_004133836.1| PREDICTED: arabinogalactan peptide 20 [Cucumis sativus] gb|KGN56462.1| hypothetical protein Csa_3G120410 [Cucumis sativus] Length = 78 Score = 69.7 bits (169), Expect = 8e-12 Identities = 31/35 (88%), Positives = 35/35 (100%) Frame = +1 Query: 274 DGTSVDQGIAYILMLVALVLTYLIHPMDASSYNFF 378 DGTS+DQGIAY+LML+ALVLTYLIHP+DASSYNFF Sbjct: 42 DGTSIDQGIAYVLMLLALVLTYLIHPLDASSYNFF 76 >ref|XP_022147463.1| arabinogalactan peptide 20-like [Momordica charantia] Length = 81 Score = 69.7 bits (169), Expect = 8e-12 Identities = 31/35 (88%), Positives = 35/35 (100%) Frame = +1 Query: 274 DGTSVDQGIAYILMLVALVLTYLIHPMDASSYNFF 378 DGTS+DQGIAY+LML+ALVLTYLIHP+DASSYNFF Sbjct: 45 DGTSIDQGIAYVLMLLALVLTYLIHPLDASSYNFF 79 >ref|XP_019234597.1| PREDICTED: arabinogalactan peptide 16-like [Nicotiana attenuata] Length = 76 Score = 69.3 bits (168), Expect = 1e-11 Identities = 36/67 (53%), Positives = 41/67 (61%) Frame = +1 Query: 178 VLTALIAIASVMLIXXXXXXXXXXXXXXXXXXDGTSVDQGIAYILMLVALVLTYLIHPMD 357 +L A+ A+A I DGTS+DQGIAY+LML ALVLTYLIHPMD Sbjct: 10 ILLAIFAMALFNFITCVQAQELAPAPAPAPTSDGTSIDQGIAYVLMLAALVLTYLIHPMD 69 Query: 358 ASSYNFF 378 AS YNFF Sbjct: 70 ASPYNFF 76 >ref|XP_021614001.1| arabinogalactan peptide 16-like [Manihot esculenta] gb|OAY49059.1| hypothetical protein MANES_05G026100 [Manihot esculenta] Length = 78 Score = 69.3 bits (168), Expect = 1e-11 Identities = 32/35 (91%), Positives = 35/35 (100%) Frame = +1 Query: 274 DGTSVDQGIAYILMLVALVLTYLIHPMDASSYNFF 378 DGTS+DQGIAYILMLVALVLTYLIHP+DASSY+FF Sbjct: 44 DGTSIDQGIAYILMLVALVLTYLIHPLDASSYSFF 78 >gb|PPS17735.1| hypothetical protein GOBAR_AA02834 [Gossypium barbadense] Length = 75 Score = 68.9 bits (167), Expect = 1e-11 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = +1 Query: 274 DGTSVDQGIAYILMLVALVLTYLIHPMDASSYNFF 378 DGTS+DQGIAYILMLVALVLTYLIHP+DASSY FF Sbjct: 41 DGTSIDQGIAYILMLVALVLTYLIHPLDASSYTFF 75 >gb|PIN26532.1| hypothetical protein CDL12_00702 [Handroanthus impetiginosus] Length = 75 Score = 68.9 bits (167), Expect = 1e-11 Identities = 31/35 (88%), Positives = 35/35 (100%) Frame = +1 Query: 274 DGTSVDQGIAYILMLVALVLTYLIHPMDASSYNFF 378 DGTS+DQGIAY+LMLVAL+LTYLIHPMDASS+NFF Sbjct: 39 DGTSIDQGIAYVLMLVALLLTYLIHPMDASSHNFF 73 >ref|XP_022770538.1| arabinogalactan peptide 20-like [Durio zibethinus] Length = 75 Score = 68.9 bits (167), Expect = 1e-11 Identities = 31/35 (88%), Positives = 35/35 (100%) Frame = +1 Query: 274 DGTSVDQGIAYILMLVALVLTYLIHPMDASSYNFF 378 DGTS+DQGIAY+LMLVALVLTYLIHP+DASSY+FF Sbjct: 41 DGTSIDQGIAYVLMLVALVLTYLIHPLDASSYSFF 75 >ref|XP_022759580.1| arabinogalactan peptide 20-like [Durio zibethinus] Length = 75 Score = 68.9 bits (167), Expect = 1e-11 Identities = 31/35 (88%), Positives = 35/35 (100%) Frame = +1 Query: 274 DGTSVDQGIAYILMLVALVLTYLIHPMDASSYNFF 378 DGTS+DQGIAY+LMLVALVLTYLIHP+DASSY+FF Sbjct: 41 DGTSIDQGIAYVLMLVALVLTYLIHPLDASSYSFF 75 >ref|XP_021280700.1| arabinogalactan peptide 20 [Herrania umbratica] Length = 75 Score = 68.9 bits (167), Expect = 1e-11 Identities = 31/35 (88%), Positives = 35/35 (100%) Frame = +1 Query: 274 DGTSVDQGIAYILMLVALVLTYLIHPMDASSYNFF 378 DGTS+DQGIAY+LMLVALVLTYLIHP+DASSY+FF Sbjct: 41 DGTSIDQGIAYVLMLVALVLTYLIHPLDASSYSFF 75 >gb|OMO64348.1| Arabinogalactan peptide, AGP [Corchorus capsularis] gb|OMP08561.1| Arabinogalactan peptide, AGP [Corchorus olitorius] Length = 75 Score = 68.9 bits (167), Expect = 1e-11 Identities = 31/35 (88%), Positives = 35/35 (100%) Frame = +1 Query: 274 DGTSVDQGIAYILMLVALVLTYLIHPMDASSYNFF 378 DGTS+DQGIAY+LMLVALVLTYLIHP+DASSY+FF Sbjct: 41 DGTSIDQGIAYVLMLVALVLTYLIHPLDASSYSFF 75 >ref|XP_007051629.2| PREDICTED: arabinogalactan peptide 20 [Theobroma cacao] Length = 75 Score = 68.9 bits (167), Expect = 1e-11 Identities = 31/35 (88%), Positives = 35/35 (100%) Frame = +1 Query: 274 DGTSVDQGIAYILMLVALVLTYLIHPMDASSYNFF 378 DGTS+DQGIAY+LMLVALVLTYLIHP+DASSY+FF Sbjct: 41 DGTSIDQGIAYVLMLVALVLTYLIHPLDASSYSFF 75 >ref|XP_016676730.1| PREDICTED: arabinogalactan peptide 20-like [Gossypium hirsutum] Length = 75 Score = 68.9 bits (167), Expect = 1e-11 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = +1 Query: 274 DGTSVDQGIAYILMLVALVLTYLIHPMDASSYNFF 378 DGTS+DQGIAYILMLVALVLTYLIHP+DASSY FF Sbjct: 41 DGTSIDQGIAYILMLVALVLTYLIHPLDASSYTFF 75