BLASTX nr result
ID: Rehmannia31_contig00000323
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00000323 (581 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDP41338.1| hypothetical protein JCGZ_15745 [Jatropha curcas] 55 6e-07 gb|OVA11010.1| hypothetical protein BVC80_1745g23 [Macleaya cord... 55 2e-06 gb|OIT00019.1| hypothetical protein A4A49_59881 [Nicotiana atten... 54 4e-06 >gb|KDP41338.1| hypothetical protein JCGZ_15745 [Jatropha curcas] Length = 71 Score = 55.1 bits (131), Expect = 6e-07 Identities = 22/31 (70%), Positives = 29/31 (93%) Frame = +2 Query: 284 KMMKAPGRDYHMPRKDFEEDPSAYFRSLRGK 376 K MKAPG+D+ +PR+DF++DP+AYFRSLRGK Sbjct: 41 KTMKAPGKDFRIPREDFDKDPAAYFRSLRGK 71 >gb|OVA11010.1| hypothetical protein BVC80_1745g23 [Macleaya cordata] Length = 138 Score = 55.5 bits (132), Expect = 2e-06 Identities = 25/38 (65%), Positives = 27/38 (71%) Frame = +2 Query: 284 KMMKAPGRDYHMPRKDFEEDPSAYFRSLRGKEKNNTFS 397 KMMKAPGRDY M R DFE DP +YF LRGK N+ S Sbjct: 87 KMMKAPGRDYRMRRSDFESDPRSYFLDLRGKRPKNSSS 124 >gb|OIT00019.1| hypothetical protein A4A49_59881 [Nicotiana attenuata] Length = 95 Score = 53.5 bits (127), Expect = 4e-06 Identities = 28/65 (43%), Positives = 35/65 (53%) Frame = +2 Query: 176 WGTSKWYEHDSSDSGFGNSXXXXXXXXXXXXXXXQEKMMKAPGRDYHMPRKDFEEDPSAY 355 WG SK + DS++ +KMMKAPGRDY++ R DFE DPS Y Sbjct: 47 WGLSKLIDGDSNERA------------------NNKKMMKAPGRDYYINRDDFERDPSGY 88 Query: 356 FRSLR 370 FR+LR Sbjct: 89 FRNLR 93