BLASTX nr result
ID: Rehmannia30_contig00035115
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00035115 (430 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU31364.1| hypothetical protein MIMGU_mgv1a013763mg [Erythra... 59 1e-07 ref|XP_012844650.1| PREDICTED: uncharacterized protein LOC105964... 59 1e-07 gb|AKN79282.1| MYB transcription factor 46 [Betula platyphylla] 57 9e-07 gb|PIN00860.1| Transcription factor, Myb superfamily [Handroanth... 57 1e-06 ref|XP_023884289.1| transcription factor MYB46-like [Quercus sub... 56 2e-06 >gb|EYU31364.1| hypothetical protein MIMGU_mgv1a013763mg [Erythranthe guttata] Length = 211 Score = 58.9 bits (141), Expect = 1e-07 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -3 Query: 428 GEELRVGEWDFEELMKDVPSFPLLDFQVE 342 GEE+RVGEWDFEELMKDV SFPLLDFQV+ Sbjct: 183 GEEVRVGEWDFEELMKDVASFPLLDFQVD 211 >ref|XP_012844650.1| PREDICTED: uncharacterized protein LOC105964694 [Erythranthe guttata] Length = 222 Score = 58.9 bits (141), Expect = 1e-07 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -3 Query: 428 GEELRVGEWDFEELMKDVPSFPLLDFQVE 342 GEE+RVGEWDFEELMKDV SFPLLDFQV+ Sbjct: 194 GEEVRVGEWDFEELMKDVASFPLLDFQVD 222 >gb|AKN79282.1| MYB transcription factor 46 [Betula platyphylla] Length = 304 Score = 57.0 bits (136), Expect = 9e-07 Identities = 24/28 (85%), Positives = 27/28 (96%) Frame = -3 Query: 425 EELRVGEWDFEELMKDVPSFPLLDFQVE 342 EE R+GEWDFEELMKDVP+FPLLDFQV+ Sbjct: 277 EEFRMGEWDFEELMKDVPTFPLLDFQVQ 304 >gb|PIN00860.1| Transcription factor, Myb superfamily [Handroanthus impetiginosus] Length = 347 Score = 56.6 bits (135), Expect = 1e-06 Identities = 24/29 (82%), Positives = 26/29 (89%) Frame = -3 Query: 428 GEELRVGEWDFEELMKDVPSFPLLDFQVE 342 GEEL++GEWD EELMKD PSFP LDFQVE Sbjct: 319 GEELKMGEWDLEELMKDAPSFPFLDFQVE 347 >ref|XP_023884289.1| transcription factor MYB46-like [Quercus suber] gb|POE70743.1| transcription factor myb46 [Quercus suber] Length = 322 Score = 56.2 bits (134), Expect = 2e-06 Identities = 27/30 (90%), Positives = 28/30 (93%), Gaps = 1/30 (3%) Frame = -3 Query: 428 GEELRVGE-WDFEELMKDVPSFPLLDFQVE 342 GEELR+GE WD EELMKDVPSFPLLDFQVE Sbjct: 293 GEELRMGEEWDLEELMKDVPSFPLLDFQVE 322