BLASTX nr result
ID: Rehmannia30_contig00034116
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00034116 (456 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011083674.1| zinc-finger homeodomain protein 5 [Sesamum i... 65 8e-10 >ref|XP_011083674.1| zinc-finger homeodomain protein 5 [Sesamum indicum] Length = 255 Score = 65.5 bits (158), Expect = 8e-10 Identities = 37/55 (67%), Positives = 42/55 (76%), Gaps = 3/55 (5%) Frame = -1 Query: 156 MSLPAGDEKEMRMQASS---NINPFENPISSPLDKPRTLDPFSGGSKSSKPTNPR 1 MS G++KEMRMQA S NIN ENPIS+P +K RTLDP SGGSKS+KPTN R Sbjct: 1 MSSIPGEDKEMRMQAPSLGYNINSLENPISAP-EKARTLDPNSGGSKSNKPTNLR 54