BLASTX nr result
ID: Rehmannia30_contig00033274
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00033274 (581 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012850561.1| PREDICTED: aspartic proteinase CDR1-like [Er... 63 4e-08 gb|EYU26313.1| hypothetical protein MIMGU_mgv11b019609mg [Erythr... 63 4e-08 ref|XP_012850560.1| PREDICTED: aspartic proteinase nepenthesin-1... 62 5e-08 gb|PIN15948.1| Aspartyl protease [Handroanthus impetiginosus] 60 3e-07 ref|XP_011098403.1| aspartic proteinase CDR1-like [Sesamum indicum] 57 3e-06 >ref|XP_012850561.1| PREDICTED: aspartic proteinase CDR1-like [Erythranthe guttata] Length = 408 Score = 62.8 bits (151), Expect = 4e-08 Identities = 25/33 (75%), Positives = 32/33 (96%) Frame = -1 Query: 578 GKRTIIGAVQQWNTRFMFDINKNVLKFYRDDCA 480 GK T+IGA+QQWNT+F+FDIN+NVLKFY+D+CA Sbjct: 375 GKTTVIGALQQWNTKFIFDINQNVLKFYKDNCA 407 >gb|EYU26313.1| hypothetical protein MIMGU_mgv11b019609mg [Erythranthe guttata] Length = 461 Score = 62.8 bits (151), Expect = 4e-08 Identities = 25/33 (75%), Positives = 32/33 (96%) Frame = -1 Query: 578 GKRTIIGAVQQWNTRFMFDINKNVLKFYRDDCA 480 GK T+IGA+QQWNT+F+FDIN+NVLKFY+D+CA Sbjct: 375 GKTTVIGALQQWNTKFIFDINQNVLKFYKDNCA 407 >ref|XP_012850560.1| PREDICTED: aspartic proteinase nepenthesin-1-like [Erythranthe guttata] gb|EYU26312.1| hypothetical protein MIMGU_mgv1a018544mg [Erythranthe guttata] Length = 400 Score = 62.4 bits (150), Expect = 5e-08 Identities = 25/33 (75%), Positives = 31/33 (93%) Frame = -1 Query: 578 GKRTIIGAVQQWNTRFMFDINKNVLKFYRDDCA 480 G+ T+IGA+QQWNTRF+FDINKNVL F++DDCA Sbjct: 367 GRSTVIGALQQWNTRFVFDINKNVLNFHKDDCA 399 >gb|PIN15948.1| Aspartyl protease [Handroanthus impetiginosus] Length = 346 Score = 60.1 bits (144), Expect = 3e-07 Identities = 23/33 (69%), Positives = 31/33 (93%) Frame = -1 Query: 578 GKRTIIGAVQQWNTRFMFDINKNVLKFYRDDCA 480 G+RT+IGAVQQW TRF+F +N+NVL+FY+DDC+ Sbjct: 312 GRRTVIGAVQQWGTRFIFYVNRNVLRFYKDDCS 344 >ref|XP_011098403.1| aspartic proteinase CDR1-like [Sesamum indicum] Length = 423 Score = 57.4 bits (137), Expect = 3e-06 Identities = 23/36 (63%), Positives = 30/36 (83%) Frame = -1 Query: 581 PGKRTIIGAVQQWNTRFMFDINKNVLKFYRDDCADD 474 PG+ +I+GA+QQWNTRF+FDIN N LKF +DC+ D Sbjct: 386 PGEVSILGALQQWNTRFVFDINTNTLKFVNEDCSKD 421