BLASTX nr result
ID: Rehmannia30_contig00033063
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00033063 (797 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN08320.1| Diacylglycerol O-acyltransferase [Handroanthus im... 57 4e-06 >gb|PIN08320.1| Diacylglycerol O-acyltransferase [Handroanthus impetiginosus] Length = 224 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -1 Query: 797 SGYSCIIVPGGVQEAFYMERGSEVYPSQLSN 705 SGYSCIIVPGGVQEAFY E+GSEVYP SN Sbjct: 189 SGYSCIIVPGGVQEAFYTEKGSEVYPLLFSN 219