BLASTX nr result
ID: Rehmannia30_contig00033016
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00033016 (455 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012827474.1| PREDICTED: uncharacterized protein LOC105948... 77 4e-15 ref|XP_011097942.1| uncharacterized protein LOC105176742 [Sesamu... 68 1e-11 gb|PIN06086.1| hypothetical protein CDL12_21365 [Handroanthus im... 60 1e-08 gb|EYU19191.1| hypothetical protein MIMGU_mgv1a026444mg [Erythra... 59 2e-08 ref|XP_012841709.1| PREDICTED: uncharacterized protein LOC105961... 59 4e-08 >ref|XP_012827474.1| PREDICTED: uncharacterized protein LOC105948793 [Erythranthe guttata] Length = 120 Score = 76.6 bits (187), Expect = 4e-15 Identities = 48/74 (64%), Positives = 54/74 (72%), Gaps = 1/74 (1%) Frame = +3 Query: 75 PSLSSISEDDVLVAER-INNVDRPAGVWRRSFKKRVSSMSSRRDLARSLDYGDLRRDQQL 251 PSLSSISED+VLVAER INN +RPA WRRS K +VSS RR ARSLD +RR Q Sbjct: 52 PSLSSISEDNVLVAERIINNGERPAERWRRSLKGKVSSSVPRR--ARSLDNYPVRRTQ-- 107 Query: 252 SLMVPVFAPSPFMF 293 L++P FAP PFMF Sbjct: 108 -LIMPPFAPMPFMF 120 >ref|XP_011097942.1| uncharacterized protein LOC105176742 [Sesamum indicum] Length = 129 Score = 67.8 bits (164), Expect = 1e-11 Identities = 40/75 (53%), Positives = 52/75 (69%), Gaps = 2/75 (2%) Frame = +3 Query: 75 PSLSSISEDDVLVAERINNVDRP--AGVWRRSFKKRVSSMSSRRDLARSLDYGDLRRDQQ 248 PSLSSISED LV ERI N +RP AG WRRS K++V+++ S RD +RS D D R Sbjct: 58 PSLSSISEDS-LVVERIRNAERPNKAG-WRRSLKRKVAALRSERDRSRSFD-RDTDRQPP 114 Query: 249 LSLMVPVFAPSPFMF 293 +S ++P F+ +PFMF Sbjct: 115 VSALMPTFSATPFMF 129 >gb|PIN06086.1| hypothetical protein CDL12_21365 [Handroanthus impetiginosus] Length = 110 Score = 59.7 bits (143), Expect = 1e-08 Identities = 33/64 (51%), Positives = 47/64 (73%), Gaps = 1/64 (1%) Frame = +3 Query: 105 VLVAERINNVDRPAGV-WRRSFKKRVSSMSSRRDLARSLDYGDLRRDQQLSLMVPVFAPS 281 VL++ERIN V+RP+ WRRS +++VSSM SR+D +R D+ D RR ++ +P FAP+ Sbjct: 49 VLISERINIVERPSEAGWRRSLERKVSSM-SRKDRSRFSDHEDGRRPSHPTI-IPTFAPT 106 Query: 282 PFMF 293 PFMF Sbjct: 107 PFMF 110 >gb|EYU19191.1| hypothetical protein MIMGU_mgv1a026444mg [Erythranthe guttata] Length = 104 Score = 58.9 bits (141), Expect = 2e-08 Identities = 36/50 (72%), Positives = 39/50 (78%), Gaps = 1/50 (2%) Frame = +3 Query: 75 PSLSSISEDDVLVAER-INNVDRPAGVWRRSFKKRVSSMSSRRDLARSLD 221 PSLSSISED+VLVAER INN +RPA WRRS K +VSS RR ARSLD Sbjct: 52 PSLSSISEDNVLVAERIINNGERPAERWRRSLKGKVSSSVPRR--ARSLD 99 >ref|XP_012841709.1| PREDICTED: uncharacterized protein LOC105961994 [Erythranthe guttata] Length = 125 Score = 58.5 bits (140), Expect = 4e-08 Identities = 37/75 (49%), Positives = 50/75 (66%), Gaps = 2/75 (2%) Frame = +3 Query: 75 PSLSSISEDDVLVAERINNVDR--PAGVWRRSFKKRVSSMSSRRDLARSLDYGDLRRDQQ 248 PSL+ ISE DV AE+ NNV+R A WRR+ K+++SS+ S+RD RS D D R Sbjct: 54 PSLAPISE-DVSTAEKANNVERTTAAAGWRRTLKRKISSV-SQRDRTRSSDC-DYGRRAP 110 Query: 249 LSLMVPVFAPSPFMF 293 L ++P F+P+PFMF Sbjct: 111 LPHVMPAFSPTPFMF 125