BLASTX nr result
ID: Rehmannia30_contig00032993
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00032993 (529 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012842740.1| PREDICTED: protein tesmin/TSO1-like CXC 5 [E... 62 4e-08 gb|EYU32939.1| hypothetical protein MIMGU_mgv1a003371mg [Erythra... 62 4e-08 ref|XP_011093606.1| protein tesmin/TSO1-like CXC 5 [Sesamum indi... 62 4e-08 ref|XP_011078441.1| protein tesmin/TSO1-like CXC 5 [Sesamum indi... 59 6e-07 >ref|XP_012842740.1| PREDICTED: protein tesmin/TSO1-like CXC 5 [Erythranthe guttata] Length = 580 Score = 62.4 bits (150), Expect = 4e-08 Identities = 30/41 (73%), Positives = 31/41 (75%) Frame = -1 Query: 124 MEQREGVDFPPKNPPSPLQLDASTAGVDFPVRKLVRQLDFT 2 MEQREG DFPPKN P P +STA DFP RKLVRQLDFT Sbjct: 1 MEQREGGDFPPKNQPPPQSEASSTAPADFPARKLVRQLDFT 41 >gb|EYU32939.1| hypothetical protein MIMGU_mgv1a003371mg [Erythranthe guttata] Length = 589 Score = 62.4 bits (150), Expect = 4e-08 Identities = 30/41 (73%), Positives = 31/41 (75%) Frame = -1 Query: 124 MEQREGVDFPPKNPPSPLQLDASTAGVDFPVRKLVRQLDFT 2 MEQREG DFPPKN P P +STA DFP RKLVRQLDFT Sbjct: 1 MEQREGGDFPPKNQPPPQSEASSTAPADFPARKLVRQLDFT 41 >ref|XP_011093606.1| protein tesmin/TSO1-like CXC 5 [Sesamum indicum] Length = 611 Score = 62.4 bits (150), Expect = 4e-08 Identities = 32/42 (76%), Positives = 33/42 (78%), Gaps = 1/42 (2%) Frame = -1 Query: 124 MEQREGVDFPPKNPPSPLQLDAS-TAGVDFPVRKLVRQLDFT 2 MEQ EG DFPPK P P Q +AS TAGVDFP RKLVRQLDFT Sbjct: 1 MEQSEGGDFPPKKQPPPPQSEASSTAGVDFPARKLVRQLDFT 42 >ref|XP_011078441.1| protein tesmin/TSO1-like CXC 5 [Sesamum indicum] Length = 601 Score = 58.9 bits (141), Expect = 6e-07 Identities = 28/41 (68%), Positives = 31/41 (75%) Frame = -1 Query: 124 MEQREGVDFPPKNPPSPLQLDASTAGVDFPVRKLVRQLDFT 2 M+Q+EG DFPPK P P +STA VDFP RKLVRQLDFT Sbjct: 1 MDQKEGGDFPPKKQPPPQSGASSTAPVDFPARKLVRQLDFT 41