BLASTX nr result
ID: Rehmannia30_contig00032845
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00032845 (460 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012843567.1| PREDICTED: phosphatidate cytidylyltransferas... 55 7e-06 >ref|XP_012843567.1| PREDICTED: phosphatidate cytidylyltransferase 4, chloroplastic-like [Erythranthe guttata] gb|EYU31955.1| hypothetical protein MIMGU_mgv1a007444mg [Erythranthe guttata] Length = 407 Score = 55.1 bits (131), Expect = 7e-06 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = +2 Query: 371 NEGLVASWPYLLGGQTVWTVGLVATLISFS 460 N VASWP LLGGQT+WTVGLVATLISFS Sbjct: 251 NSRFVASWPILLGGQTIWTVGLVATLISFS 280