BLASTX nr result
ID: Rehmannia30_contig00031432
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00031432 (438 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020552940.1| calmodulin-binding protein 60 C-like [Sesamu... 59 4e-07 >ref|XP_020552940.1| calmodulin-binding protein 60 C-like [Sesamum indicum] Length = 555 Score = 58.5 bits (140), Expect = 4e-07 Identities = 29/32 (90%), Positives = 29/32 (90%) Frame = -2 Query: 98 MVLKRQLREGAEEGSELPFKRRHLNSTIFKGL 3 MVLKRQLREG EEGSELP KRRHL STIFKGL Sbjct: 1 MVLKRQLREGGEEGSELPTKRRHLVSTIFKGL 32