BLASTX nr result
ID: Rehmannia30_contig00031357
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00031357 (411 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011095691.1| cysteine-rich and transmembrane domain-conta... 71 2e-13 ref|XP_022871893.1| cysteine-rich and transmembrane domain-conta... 70 2e-13 ref|XP_011095692.1| cysteine-rich and transmembrane domain-conta... 69 9e-13 ref|XP_012848622.1| PREDICTED: cysteine-rich and transmembrane d... 65 3e-11 ref|XP_022871894.1| cysteine-rich and transmembrane domain-conta... 64 5e-11 gb|PIN10998.1| hypothetical protein CDL12_16404 [Handroanthus im... 60 1e-09 ref|XP_022848329.1| cysteine-rich and transmembrane domain-conta... 60 2e-09 gb|PIN05501.1| hypothetical protein CDL12_21960 [Handroanthus im... 52 3e-06 >ref|XP_011095691.1| cysteine-rich and transmembrane domain-containing protein A-like isoform X1 [Sesamum indicum] Length = 81 Score = 70.9 bits (172), Expect = 2e-13 Identities = 33/62 (53%), Positives = 41/62 (66%) Frame = -2 Query: 407 MNQYDQQHQVSVGXXXXXXXXXXXXXXSYNGPYVMAPPPIGYPTKEGNHQGDVPVDTTTR 228 M+QY+QQHQ V YNGPYVMAPPP+GYPTK+ +QG VP++TT+R Sbjct: 1 MSQYNQQHQAPVAHPPPPTSYPPPADS-YNGPYVMAPPPMGYPTKDDRNQGQVPMETTSR 59 Query: 227 GD 222 GD Sbjct: 60 GD 61 >ref|XP_022871893.1| cysteine-rich and transmembrane domain-containing protein WIH2-like isoform X1 [Olea europaea var. sylvestris] Length = 81 Score = 70.5 bits (171), Expect = 2e-13 Identities = 32/62 (51%), Positives = 43/62 (69%) Frame = -2 Query: 407 MNQYDQQHQVSVGXXXXXXXXXXXXXXSYNGPYVMAPPPIGYPTKEGNHQGDVPVDTTTR 228 MN+YDQ H+ SV + +GPYVMAPPP+GYPTK+G+++G+ PV+TTTR Sbjct: 1 MNKYDQ-HEASVAYPAPPPSYPPGTQGNLDGPYVMAPPPVGYPTKDGDNKGNAPVETTTR 59 Query: 227 GD 222 GD Sbjct: 60 GD 61 >ref|XP_011095692.1| cysteine-rich and transmembrane domain-containing protein A-like isoform X2 [Sesamum indicum] Length = 80 Score = 68.9 bits (167), Expect = 9e-13 Identities = 33/62 (53%), Positives = 41/62 (66%) Frame = -2 Query: 407 MNQYDQQHQVSVGXXXXXXXXXXXXXXSYNGPYVMAPPPIGYPTKEGNHQGDVPVDTTTR 228 M+QY+QQHQ SYNGPYVMAPPP+GYPTK+ +QG VP++TT+R Sbjct: 1 MSQYNQQHQAPA--HPPPPTSYPPPADSYNGPYVMAPPPMGYPTKDDRNQGQVPMETTSR 58 Query: 227 GD 222 GD Sbjct: 59 GD 60 >ref|XP_012848622.1| PREDICTED: cysteine-rich and transmembrane domain-containing protein A-like [Erythranthe guttata] gb|EYU27542.1| hypothetical protein MIMGU_mgv1a017365mg [Erythranthe guttata] Length = 79 Score = 65.1 bits (157), Expect = 3e-11 Identities = 33/63 (52%), Positives = 37/63 (58%), Gaps = 1/63 (1%) Frame = -2 Query: 407 MNQYDQQHQVSVGXXXXXXXXXXXXXXSYNG-PYVMAPPPIGYPTKEGNHQGDVPVDTTT 231 MNQYDQ HQV+ YNG YV APPPIGYP K+GN G PV+TT+ Sbjct: 1 MNQYDQHHQVAAAYPAPPTSYPDT----YNGGQYVTAPPPIGYPAKDGNQNGQAPVETTS 56 Query: 230 RGD 222 RGD Sbjct: 57 RGD 59 >ref|XP_022871894.1| cysteine-rich and transmembrane domain-containing protein WIH1-like isoform X2 [Olea europaea var. sylvestris] Length = 77 Score = 64.3 bits (155), Expect = 5e-11 Identities = 31/62 (50%), Positives = 42/62 (67%) Frame = -2 Query: 407 MNQYDQQHQVSVGXXXXXXXXXXXXXXSYNGPYVMAPPPIGYPTKEGNHQGDVPVDTTTR 228 MN+YDQ H+ S + +GPYVMAPPP+GYPTK+G+++G+ PV+TTTR Sbjct: 1 MNKYDQ-HEASA----PPPSYPPGTQGNLDGPYVMAPPPVGYPTKDGDNKGNAPVETTTR 55 Query: 227 GD 222 GD Sbjct: 56 GD 57 >gb|PIN10998.1| hypothetical protein CDL12_16404 [Handroanthus impetiginosus] Length = 60 Score = 60.5 bits (145), Expect = 1e-09 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = -2 Query: 323 YNGPYVMAPPPIGYPTKEGNHQGDVPVDTTTRG 225 YNGPYVMAPPP GY T++GN QG VPV+TT+RG Sbjct: 21 YNGPYVMAPPPTGYHTRDGNSQGRVPVETTSRG 53 >ref|XP_022848329.1| cysteine-rich and transmembrane domain-containing protein WIH1-like [Olea europaea var. sylvestris] Length = 77 Score = 60.1 bits (144), Expect = 2e-09 Identities = 23/33 (69%), Positives = 31/33 (93%) Frame = -2 Query: 320 NGPYVMAPPPIGYPTKEGNHQGDVPVDTTTRGD 222 +GPYVMAPPP+GYPTK+G+++G+ PV+TT RGD Sbjct: 25 DGPYVMAPPPMGYPTKDGDNRGNAPVETTNRGD 57 >gb|PIN05501.1| hypothetical protein CDL12_21960 [Handroanthus impetiginosus] Length = 77 Score = 52.0 bits (123), Expect = 3e-06 Identities = 29/63 (46%), Positives = 34/63 (53%), Gaps = 1/63 (1%) Frame = -2 Query: 407 MNQYDQQHQVSVGXXXXXXXXXXXXXXSYNGPYVMAPPPIGYPTKE-GNHQGDVPVDTTT 231 MNQYDQQ+Q Y G YV APPP+GYPTKE GN+Q +T + Sbjct: 1 MNQYDQQYQAP------PTSYPPPAADGYKGQYVTAPPPMGYPTKEDGNNQRPGSAETKS 54 Query: 230 RGD 222 RGD Sbjct: 55 RGD 57