BLASTX nr result
ID: Rehmannia30_contig00031023
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00031023 (574 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011073244.1| ABC transporter I family member 17 [Sesamum ... 65 4e-09 ref|XP_020267719.1| protein STAR1-like isoform X2 [Asparagus off... 60 3e-08 ref|XP_020267718.1| protein STAR1-like isoform X1 [Asparagus off... 60 3e-08 gb|EPS72839.1| hypothetical protein M569_01919, partial [Genlise... 62 3e-08 ref|XP_017255874.1| PREDICTED: ABC transporter I family member 1... 62 4e-08 gb|PIN03661.1| putative ABC-type transport, ATPase component/CCR... 61 8e-08 gb|PIN01585.1| putative ABC-type transport, ATPase component/CCR... 61 8e-08 ref|XP_010110724.1| ABC transporter I family member 17 [Morus no... 61 8e-08 gb|KZV21421.1| ABC transporter I family member 17-like [Dorcocer... 60 1e-07 ref|XP_010265392.1| PREDICTED: ABC transporter I family member 1... 59 2e-07 ref|XP_011082719.1| ABC transporter I family member 17 [Sesamum ... 60 2e-07 gb|KZV44185.1| ABC transporter I family member 17 [Dorcoceras hy... 60 3e-07 ref|XP_012856225.1| PREDICTED: ABC transporter I family member 1... 60 3e-07 ref|XP_010265391.1| PREDICTED: ABC transporter I family member 1... 59 3e-07 ref|XP_010265390.1| PREDICTED: ABC transporter I family member 1... 59 4e-07 ref|XP_019243937.1| PREDICTED: ABC transporter I family member 1... 59 5e-07 ref|XP_009788357.1| PREDICTED: ABC transporter I family member 1... 59 5e-07 ref|XP_010322648.1| PREDICTED: LOW QUALITY PROTEIN: ABC transpor... 59 6e-07 ref|XP_006366268.1| PREDICTED: ABC transporter I family member 1... 59 6e-07 ref|XP_022870371.1| protein STAR1-like [Olea europaea var. sylve... 58 8e-07 >ref|XP_011073244.1| ABC transporter I family member 17 [Sesamum indicum] Length = 260 Score = 64.7 bits (156), Expect = 4e-09 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 571 VLLDGVDICELDVLNLRRKVGMLFQLPVLFEG 476 VLLDGVDICELDVL+LRRKVGMLFQLPVLFEG Sbjct: 84 VLLDGVDICELDVLSLRRKVGMLFQLPVLFEG 115 >ref|XP_020267719.1| protein STAR1-like isoform X2 [Asparagus officinalis] Length = 139 Score = 60.5 bits (145), Expect = 3e-08 Identities = 30/36 (83%), Positives = 31/36 (86%) Frame = -1 Query: 571 VLLDGVDICELDVLNLRRKVGMLFQLPVLFEGKLCL 464 V LDG DIC LDVL+LRRKVGMLFQLP LFEGKL L Sbjct: 90 VFLDGDDICGLDVLSLRRKVGMLFQLPALFEGKLYL 125 >ref|XP_020267718.1| protein STAR1-like isoform X1 [Asparagus officinalis] Length = 142 Score = 60.5 bits (145), Expect = 3e-08 Identities = 30/36 (83%), Positives = 31/36 (86%) Frame = -1 Query: 571 VLLDGVDICELDVLNLRRKVGMLFQLPVLFEGKLCL 464 V LDG DIC LDVL+LRRKVGMLFQLP LFEGKL L Sbjct: 93 VFLDGDDICGLDVLSLRRKVGMLFQLPALFEGKLYL 128 >gb|EPS72839.1| hypothetical protein M569_01919, partial [Genlisea aurea] Length = 256 Score = 62.4 bits (150), Expect = 3e-08 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -1 Query: 571 VLLDGVDICELDVLNLRRKVGMLFQLPVLFEG 476 V LDGVDIC+LDVLNLRR+VGMLFQLPVLFEG Sbjct: 79 VFLDGVDICKLDVLNLRRRVGMLFQLPVLFEG 110 >ref|XP_017255874.1| PREDICTED: ABC transporter I family member 17 [Daucus carota subsp. sativus] gb|KZM91252.1| hypothetical protein DCAR_021383 [Daucus carota subsp. sativus] Length = 262 Score = 62.0 bits (149), Expect = 4e-08 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -1 Query: 571 VLLDGVDICELDVLNLRRKVGMLFQLPVLFEG 476 V LDGVDIC+LDVL+LRRKVGMLFQLPVLFEG Sbjct: 85 VFLDGVDICDLDVLSLRRKVGMLFQLPVLFEG 116 >gb|PIN03661.1| putative ABC-type transport, ATPase component/CCR4 associated factor [Handroanthus impetiginosus] Length = 262 Score = 61.2 bits (147), Expect = 8e-08 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = -1 Query: 571 VLLDGVDICELDVLNLRRKVGMLFQLPVLFEGKL 470 V LDGVDICELDVL+LRR+VGMLFQLPVLF+G + Sbjct: 85 VFLDGVDICELDVLSLRRRVGMLFQLPVLFQGSV 118 >gb|PIN01585.1| putative ABC-type transport, ATPase component/CCR4 associated factor [Handroanthus impetiginosus] Length = 262 Score = 61.2 bits (147), Expect = 8e-08 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -1 Query: 571 VLLDGVDICELDVLNLRRKVGMLFQLPVLFEG 476 V LDGVDIC +DVLNLRR+VGMLFQLPVLFEG Sbjct: 85 VFLDGVDICHIDVLNLRRRVGMLFQLPVLFEG 116 >ref|XP_010110724.1| ABC transporter I family member 17 [Morus notabilis] gb|EXC27889.1| ABC transporter I family member 17 [Morus notabilis] Length = 264 Score = 61.2 bits (147), Expect = 8e-08 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -1 Query: 571 VLLDGVDICELDVLNLRRKVGMLFQLPVLFEG 476 VLLDG DICE+DVL+LRRKVGMLFQLPVLFEG Sbjct: 87 VLLDGRDICEIDVLDLRRKVGMLFQLPVLFEG 118 >gb|KZV21421.1| ABC transporter I family member 17-like [Dorcoceras hygrometricum] Length = 264 Score = 60.5 bits (145), Expect = 1e-07 Identities = 26/34 (76%), Positives = 32/34 (94%) Frame = -1 Query: 571 VLLDGVDICELDVLNLRRKVGMLFQLPVLFEGKL 470 V LDGVDICELDV++LRRK+GMLFQ+PV+FEG + Sbjct: 87 VFLDGVDICELDVISLRRKIGMLFQVPVMFEGSV 120 >ref|XP_010265392.1| PREDICTED: ABC transporter I family member 17 isoform X3 [Nelumbo nucifera] Length = 192 Score = 59.3 bits (142), Expect = 2e-07 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -1 Query: 571 VLLDGVDICELDVLNLRRKVGMLFQLPVLFEG 476 VLLDG DIC+LDVL LRRKVGMLFQLPVLF+G Sbjct: 84 VLLDGRDICDLDVLTLRRKVGMLFQLPVLFDG 115 >ref|XP_011082719.1| ABC transporter I family member 17 [Sesamum indicum] Length = 260 Score = 60.1 bits (144), Expect = 2e-07 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = -1 Query: 571 VLLDGVDICELDVLNLRRKVGMLFQLPVLFEG 476 V LDGVDIC+LDVL+LRR+VGMLFQLPV+FEG Sbjct: 83 VFLDGVDICQLDVLHLRRRVGMLFQLPVMFEG 114 >gb|KZV44185.1| ABC transporter I family member 17 [Dorcoceras hygrometricum] Length = 260 Score = 59.7 bits (143), Expect = 3e-07 Identities = 28/32 (87%), Positives = 28/32 (87%) Frame = -1 Query: 571 VLLDGVDICELDVLNLRRKVGMLFQLPVLFEG 476 V LDG DICELDVL LRRKVGMLFQLP LFEG Sbjct: 83 VFLDGADICELDVLELRRKVGMLFQLPALFEG 114 >ref|XP_012856225.1| PREDICTED: ABC transporter I family member 17 [Erythranthe guttata] gb|EYU21787.1| hypothetical protein MIMGU_mgv1a012074mg [Erythranthe guttata] Length = 262 Score = 59.7 bits (143), Expect = 3e-07 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -1 Query: 571 VLLDGVDICELDVLNLRRKVGMLFQLPVLFEG 476 V LDGVDIC++DVL LRRKVGMLFQLPVLF+G Sbjct: 85 VFLDGVDICDIDVLTLRRKVGMLFQLPVLFQG 116 >ref|XP_010265391.1| PREDICTED: ABC transporter I family member 17 isoform X2 [Nelumbo nucifera] Length = 253 Score = 59.3 bits (142), Expect = 3e-07 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -1 Query: 571 VLLDGVDICELDVLNLRRKVGMLFQLPVLFEG 476 VLLDG DIC+LDVL LRRKVGMLFQLPVLF+G Sbjct: 84 VLLDGRDICDLDVLTLRRKVGMLFQLPVLFDG 115 >ref|XP_010265390.1| PREDICTED: ABC transporter I family member 17 isoform X1 [Nelumbo nucifera] Length = 261 Score = 59.3 bits (142), Expect = 4e-07 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = -1 Query: 571 VLLDGVDICELDVLNLRRKVGMLFQLPVLFEG 476 VLLDG DIC+LDVL LRRKVGMLFQLPVLF+G Sbjct: 84 VLLDGRDICDLDVLTLRRKVGMLFQLPVLFDG 115 >ref|XP_019243937.1| PREDICTED: ABC transporter I family member 17 [Nicotiana attenuata] gb|OIT05136.1| abc transporter i family member 17 [Nicotiana attenuata] Length = 260 Score = 58.9 bits (141), Expect = 5e-07 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -1 Query: 571 VLLDGVDICELDVLNLRRKVGMLFQLPVLFEG 476 V LDG DIC+LDVL LRRK+GMLFQLPVLFEG Sbjct: 83 VFLDGQDICDLDVLTLRRKIGMLFQLPVLFEG 114 >ref|XP_009788357.1| PREDICTED: ABC transporter I family member 17 [Nicotiana sylvestris] ref|XP_016503576.1| PREDICTED: ABC transporter I family member 17-like [Nicotiana tabacum] Length = 260 Score = 58.9 bits (141), Expect = 5e-07 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -1 Query: 571 VLLDGVDICELDVLNLRRKVGMLFQLPVLFEG 476 V LDG DIC+LDVL LRRK+GMLFQLPVLFEG Sbjct: 83 VFLDGQDICDLDVLTLRRKIGMLFQLPVLFEG 114 >ref|XP_010322648.1| PREDICTED: LOW QUALITY PROTEIN: ABC transporter I family member 17 [Solanum lycopersicum] Length = 280 Score = 58.9 bits (141), Expect = 6e-07 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -1 Query: 571 VLLDGVDICELDVLNLRRKVGMLFQLPVLFEG 476 V LDG DIC+LDVL LRRKVGMLFQLPVLFEG Sbjct: 103 VFLDGTDICDLDVLCLRRKVGMLFQLPVLFEG 134 >ref|XP_006366268.1| PREDICTED: ABC transporter I family member 17-like [Solanum tuberosum] Length = 280 Score = 58.9 bits (141), Expect = 6e-07 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -1 Query: 571 VLLDGVDICELDVLNLRRKVGMLFQLPVLFEG 476 V LDG DIC+LDVL LRRKVGMLFQLPVLFEG Sbjct: 103 VFLDGTDICDLDVLCLRRKVGMLFQLPVLFEG 134 >ref|XP_022870371.1| protein STAR1-like [Olea europaea var. sylvestris] Length = 247 Score = 58.2 bits (139), Expect = 8e-07 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -1 Query: 571 VLLDGVDICELDVLNLRRKVGMLFQLPVLFEG 476 V LDGVDIC+LDVL +RRKVGMLFQLP +FEG Sbjct: 89 VFLDGVDICDLDVLGVRRKVGMLFQLPAIFEG 120