BLASTX nr result
ID: Rehmannia30_contig00029480
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00029480 (408 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011095572.1| far upstream element-binding protein 2 isofo... 54 9e-06 ref|XP_011095563.1| far upstream element-binding protein 2 isofo... 54 9e-06 >ref|XP_011095572.1| far upstream element-binding protein 2 isoform X2 [Sesamum indicum] Length = 727 Score = 54.3 bits (129), Expect = 9e-06 Identities = 31/62 (50%), Positives = 35/62 (56%), Gaps = 1/62 (1%) Frame = +1 Query: 7 SGYAQLSQTQHSYDQSGGYGSVPASGGYG-NVPASAGYGKXXXXXXXXXXXXXXXXMYGA 183 SGYAQ SQTQ YDQ+GGYG+VPA GYG +V A Y + MYGA Sbjct: 677 SGYAQPSQTQPGYDQAGGYGNVPAPAGYGKSVSPQAAYAQ-----------YDSSQMYGA 725 Query: 184 HR 189 HR Sbjct: 726 HR 727 >ref|XP_011095563.1| far upstream element-binding protein 2 isoform X1 [Sesamum indicum] Length = 728 Score = 54.3 bits (129), Expect = 9e-06 Identities = 31/62 (50%), Positives = 35/62 (56%), Gaps = 1/62 (1%) Frame = +1 Query: 7 SGYAQLSQTQHSYDQSGGYGSVPASGGYG-NVPASAGYGKXXXXXXXXXXXXXXXXMYGA 183 SGYAQ SQTQ YDQ+GGYG+VPA GYG +V A Y + MYGA Sbjct: 678 SGYAQPSQTQPGYDQAGGYGNVPAPAGYGKSVSPQAAYAQ-----------YDSSQMYGA 726 Query: 184 HR 189 HR Sbjct: 727 HR 728