BLASTX nr result
ID: Rehmannia30_contig00029230
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00029230 (588 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012851708.1| PREDICTED: keratin-associated protein 6-2 [E... 55 1e-06 >ref|XP_012851708.1| PREDICTED: keratin-associated protein 6-2 [Erythranthe guttata] gb|EYU25497.1| hypothetical protein MIMGU_mgv1a017008mg [Erythranthe guttata] Length = 97 Score = 55.1 bits (131), Expect = 1e-06 Identities = 29/68 (42%), Positives = 32/68 (47%) Frame = +2 Query: 116 MPLNIFXXXXXXXXXXXXXXXXXXXTAYGSKYHSSAVTFQGIEFXXXXXXXXXXXNLLNN 295 MPLNIF +AYGS+YH S TFQG+EF NLL N Sbjct: 30 MPLNIFGLGAGGGCGVGLGLGWGFGSAYGSQYHGSGATFQGVEFASKSNVEKDSTNLLKN 89 Query: 296 TQKTNVSN 319 TQK N SN Sbjct: 90 TQKANASN 97