BLASTX nr result
ID: Rehmannia30_contig00029228
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00029228 (440 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012847909.1| PREDICTED: U-box domain-containing protein 5... 59 3e-07 >ref|XP_012847909.1| PREDICTED: U-box domain-containing protein 5 [Erythranthe guttata] Length = 755 Score = 58.9 bits (141), Expect = 3e-07 Identities = 30/45 (66%), Positives = 34/45 (75%), Gaps = 1/45 (2%) Frame = -2 Query: 133 LLDVLCLAEFFVFEGTVFL-MGNHVAEVVEGLPSAKTIKAHARMC 2 LL V+ FF FE VFL MGNH+AEVV+GLPSA+ IK HARMC Sbjct: 3 LLQVIFFHFFFEFETIVFLPMGNHIAEVVDGLPSARNIKVHARMC 47