BLASTX nr result
ID: Rehmannia30_contig00029069
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia30_contig00029069 (701 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011090543.1| cyclin-dependent kinase C-1 [Sesamum indicum] 128 1e-30 gb|PIN26771.1| Cdc2-related protein kinase [Handroanthus impetig... 127 2e-30 ref|XP_012845335.1| PREDICTED: cyclin-dependent kinase C-1 [Eryt... 118 4e-27 gb|KZV53754.1| cyclin-dependent kinase C-1-like [Dorcoceras hygr... 106 9e-23 gb|PHT35660.1| Cyclin-dependent kinase C-2 [Capsicum baccatum] 99 1e-21 ref|XP_019260893.1| PREDICTED: cyclin-dependent kinase C-1-like ... 100 1e-20 gb|PHU00836.1| Cyclin-dependent kinase C-2 [Capsicum chinense] 97 3e-20 ref|XP_009627964.1| PREDICTED: cyclin-dependent kinase C-1-like ... 98 6e-20 ref|XP_019182951.1| PREDICTED: cyclin-dependent kinase C-1-like ... 98 9e-20 ref|XP_016550229.1| PREDICTED: cyclin-dependent kinase C-1 isofo... 97 1e-19 ref|XP_016550228.1| PREDICTED: cyclin-dependent kinase C-1 isofo... 97 1e-19 ref|NP_001312143.1| cyclin-dependent kinase C-1-like [Nicotiana ... 97 2e-19 ref|XP_010319696.1| PREDICTED: cyclin dependent kinase C isoform... 96 3e-19 ref|XP_006355337.1| PREDICTED: cyclin-dependent kinase C-1-like ... 96 3e-19 ref|NP_001234799.1| cyclin dependent kinase C [Solanum lycopersi... 96 3e-19 ref|XP_015071461.1| PREDICTED: cyclin-dependent kinase C-1-like ... 96 3e-19 ref|XP_010319695.1| PREDICTED: cyclin dependent kinase C isoform... 96 3e-19 ref|XP_022870820.1| cyclin-dependent kinase C-1-like [Olea europ... 90 2e-18 dbj|GAV84781.1| Pkinase domain-containing protein [Cephalotus fo... 88 3e-16 ref|XP_023901394.1| cyclin-dependent kinase C-1-like [Quercus su... 86 1e-15 >ref|XP_011090543.1| cyclin-dependent kinase C-1 [Sesamum indicum] Length = 512 Score = 128 bits (321), Expect = 1e-30 Identities = 56/67 (83%), Positives = 59/67 (88%) Frame = -3 Query: 663 QDRGGQSGGYNSGPYPSQGRVPPSYPGNNAPSNGPRGNAGGYGAPPNFSQSGQYGVSGGR 484 QDRGGQSGGYNSGP+P QGR PP YPGN+APSN PRG GGYGAPPN+SQSGQYGVSGGR Sbjct: 436 QDRGGQSGGYNSGPFPPQGRGPPLYPGNSAPSNAPRGTGGGYGAPPNYSQSGQYGVSGGR 495 Query: 483 GSNPVGG 463 G NP GG Sbjct: 496 GPNPQGG 502 >gb|PIN26771.1| Cdc2-related protein kinase [Handroanthus impetiginosus] Length = 511 Score = 127 bits (320), Expect = 2e-30 Identities = 58/67 (86%), Positives = 60/67 (89%) Frame = -3 Query: 663 QDRGGQSGGYNSGPYPSQGRVPPSYPGNNAPSNGPRGNAGGYGAPPNFSQSGQYGVSGGR 484 QDRGGQSGGYNSGPYP QGR PP YPGN+AP NGPRG AGGYGAPPNFSQS QYGVSGGR Sbjct: 436 QDRGGQSGGYNSGPYPPQGRGPPPYPGNSAP-NGPRGTAGGYGAPPNFSQSSQYGVSGGR 494 Query: 483 GSNPVGG 463 G NP+GG Sbjct: 495 GPNPMGG 501 >ref|XP_012845335.1| PREDICTED: cyclin-dependent kinase C-1 [Erythranthe guttata] gb|EYU31006.1| hypothetical protein MIMGU_mgv1a004642mg [Erythranthe guttata] Length = 517 Score = 118 bits (296), Expect = 4e-27 Identities = 55/75 (73%), Positives = 59/75 (78%), Gaps = 8/75 (10%) Frame = -3 Query: 663 QDRGGQ--------SGGYNSGPYPSQGRVPPSYPGNNAPSNGPRGNAGGYGAPPNFSQSG 508 QDRGGQ SG Y+SGPYPSQGR PP YPGN+APSNGPRG GGY APPN++QSG Sbjct: 433 QDRGGQGQSQSQSQSGAYSSGPYPSQGRGPPPYPGNSAPSNGPRGTGGGYVAPPNYTQSG 492 Query: 507 QYGVSGGRGSNPVGG 463 QYGVSGGRG NP GG Sbjct: 493 QYGVSGGRGQNPPGG 507 >gb|KZV53754.1| cyclin-dependent kinase C-1-like [Dorcoceras hygrometricum] Length = 595 Score = 106 bits (265), Expect = 9e-23 Identities = 48/67 (71%), Positives = 54/67 (80%) Frame = -3 Query: 663 QDRGGQSGGYNSGPYPSQGRVPPSYPGNNAPSNGPRGNAGGYGAPPNFSQSGQYGVSGGR 484 Q+RGGQSG YNSG YP GR PP Y GN+AP NGP+G +GGYG PPN+ QSGQYGVSGGR Sbjct: 520 QERGGQSGAYNSGSYPPHGRGPP-YTGNSAPPNGPQGASGGYGPPPNYPQSGQYGVSGGR 578 Query: 483 GSNPVGG 463 G N +GG Sbjct: 579 GPNQMGG 585 >gb|PHT35660.1| Cyclin-dependent kinase C-2 [Capsicum baccatum] Length = 205 Score = 98.6 bits (244), Expect = 1e-21 Identities = 47/64 (73%), Positives = 50/64 (78%), Gaps = 1/64 (1%) Frame = -3 Query: 663 QDRGGQSGGYNSGPYPSQGRVPPSYPGNNAPSNGPRGNAGGYGAPPNFSQSGQYGVSG-G 487 QDRG Q GGY SG YP QGR PP YPG+ S+GPRG GGYGAPPN+SQSGQYG SG G Sbjct: 127 QDRGAQGGGYRSGAYPPQGRAPP-YPGSGVASSGPRGPTGGYGAPPNYSQSGQYGGSGAG 185 Query: 486 RGSN 475 RGSN Sbjct: 186 RGSN 189 >ref|XP_019260893.1| PREDICTED: cyclin-dependent kinase C-1-like [Nicotiana attenuata] gb|OIT38854.1| cyclin-dependent kinase c-2 [Nicotiana attenuata] Length = 509 Score = 100 bits (248), Expect = 1e-20 Identities = 47/68 (69%), Positives = 53/68 (77%), Gaps = 1/68 (1%) Frame = -3 Query: 663 QDRGGQSGGYNSGPYPSQGRVPPSYPGNNAPSNGPRGNAGGYGAPPNFSQSGQYGVSG-G 487 QDRG Q GGY+SG YP QGR PP YPG+ S+GPRG +GGYG PPN+SQSGQYG SG G Sbjct: 433 QDRGAQGGGYSSGTYPPQGRAPP-YPGSGVASSGPRGPSGGYGVPPNYSQSGQYGGSGTG 491 Query: 486 RGSNPVGG 463 RGSN + G Sbjct: 492 RGSNQMSG 499 >gb|PHU00836.1| Cyclin-dependent kinase C-2 [Capsicum chinense] Length = 336 Score = 97.4 bits (241), Expect = 3e-20 Identities = 46/68 (67%), Positives = 51/68 (75%), Gaps = 1/68 (1%) Frame = -3 Query: 663 QDRGGQSGGYNSGPYPSQGRVPPSYPGNNAPSNGPRGNAGGYGAPPNFSQSGQYGVSG-G 487 QDRG Q GGY+SG YP QGR PP YP + S+GPRG GGYG PPN+SQSGQYG SG G Sbjct: 260 QDRGAQGGGYSSGAYPPQGRAPP-YPSSGVASSGPRGPTGGYGVPPNYSQSGQYGGSGAG 318 Query: 486 RGSNPVGG 463 RGSN + G Sbjct: 319 RGSNQMNG 326 >ref|XP_009627964.1| PREDICTED: cyclin-dependent kinase C-1-like [Nicotiana tomentosiformis] ref|XP_016484276.1| PREDICTED: cyclin-dependent kinase C-1-like [Nicotiana tabacum] Length = 509 Score = 98.2 bits (243), Expect = 6e-20 Identities = 46/68 (67%), Positives = 53/68 (77%), Gaps = 1/68 (1%) Frame = -3 Query: 663 QDRGGQSGGYNSGPYPSQGRVPPSYPGNNAPSNGPRGNAGGYGAPPNFSQSGQYGVSG-G 487 QDRG Q GGY+SG YP QGR PP YPG+ S+GPRG +GGYG PP++SQSGQYG SG G Sbjct: 433 QDRGAQGGGYSSGTYPPQGRAPP-YPGSGVASSGPRGPSGGYGVPPSYSQSGQYGGSGAG 491 Query: 486 RGSNPVGG 463 RGSN + G Sbjct: 492 RGSNQMSG 499 >ref|XP_019182951.1| PREDICTED: cyclin-dependent kinase C-1-like [Ipomoea nil] Length = 512 Score = 97.8 bits (242), Expect = 9e-20 Identities = 45/68 (66%), Positives = 52/68 (76%), Gaps = 1/68 (1%) Frame = -3 Query: 663 QDRGGQSGGYNSGPYPSQGRVPPSYPGNNAPSNGPRGNAGGYGAPPNFSQSGQYGVSG-G 487 QDRGGQ G Y+SGPYP QGR PP YP + ++GPRG +GGYG PPN+SQSGQYG S G Sbjct: 436 QDRGGQGGNYSSGPYPPQGRAPP-YPASGVANSGPRGASGGYGVPPNYSQSGQYGGSNTG 494 Query: 486 RGSNPVGG 463 RG N +GG Sbjct: 495 RGPNQMGG 502 >ref|XP_016550229.1| PREDICTED: cyclin-dependent kinase C-1 isoform X2 [Capsicum annuum] gb|PHT65923.1| Cyclin-dependent kinase C-2 [Capsicum annuum] Length = 511 Score = 97.4 bits (241), Expect = 1e-19 Identities = 46/68 (67%), Positives = 51/68 (75%), Gaps = 1/68 (1%) Frame = -3 Query: 663 QDRGGQSGGYNSGPYPSQGRVPPSYPGNNAPSNGPRGNAGGYGAPPNFSQSGQYGVSG-G 487 QDRG Q GGY+SG YP QGR PP YP + S+GPRG GGYG PPN+SQSGQYG SG G Sbjct: 435 QDRGAQGGGYSSGAYPPQGRAPP-YPSSGVASSGPRGPTGGYGVPPNYSQSGQYGGSGAG 493 Query: 486 RGSNPVGG 463 RGSN + G Sbjct: 494 RGSNQMNG 501 >ref|XP_016550228.1| PREDICTED: cyclin-dependent kinase C-1 isoform X1 [Capsicum annuum] Length = 542 Score = 97.4 bits (241), Expect = 1e-19 Identities = 46/68 (67%), Positives = 51/68 (75%), Gaps = 1/68 (1%) Frame = -3 Query: 663 QDRGGQSGGYNSGPYPSQGRVPPSYPGNNAPSNGPRGNAGGYGAPPNFSQSGQYGVSG-G 487 QDRG Q GGY+SG YP QGR PP YP + S+GPRG GGYG PPN+SQSGQYG SG G Sbjct: 466 QDRGAQGGGYSSGAYPPQGRAPP-YPSSGVASSGPRGPTGGYGVPPNYSQSGQYGGSGAG 524 Query: 486 RGSNPVGG 463 RGSN + G Sbjct: 525 RGSNQMNG 532 >ref|NP_001312143.1| cyclin-dependent kinase C-1-like [Nicotiana tabacum] ref|XP_009792780.1| PREDICTED: cyclin-dependent kinase C-1-like [Nicotiana sylvestris] gb|AIE54287.1| cyclin dependent kinase C [Nicotiana tabacum] Length = 508 Score = 96.7 bits (239), Expect = 2e-19 Identities = 46/68 (67%), Positives = 52/68 (76%), Gaps = 1/68 (1%) Frame = -3 Query: 663 QDRGGQSGGYNSGPYPSQGRVPPSYPGNNAPSNGPRGNAGGYGAPPNFSQSGQYGVSG-G 487 QDRG Q GGY+SG YP QGR PP YPG+ S+ PRG +GGYG PPN+SQSGQYG SG G Sbjct: 432 QDRGAQGGGYSSGTYPPQGRAPP-YPGSGVASSVPRGPSGGYGVPPNYSQSGQYGGSGTG 490 Query: 486 RGSNPVGG 463 RGSN + G Sbjct: 491 RGSNQMSG 498 >ref|XP_010319696.1| PREDICTED: cyclin dependent kinase C isoform X2 [Solanum lycopersicum] Length = 472 Score = 96.3 bits (238), Expect = 3e-19 Identities = 45/68 (66%), Positives = 52/68 (76%), Gaps = 1/68 (1%) Frame = -3 Query: 663 QDRGGQSGGYNSGPYPSQGRVPPSYPGNNAPSNGPRGNAGGYGAPPNFSQSGQYGVSG-G 487 QDRG Q GGY+SG YP QGR PP +PG+ +GPRG +GGYG PPN+SQSGQYG SG G Sbjct: 396 QDRGAQGGGYSSGAYPPQGRAPP-FPGSGLAPSGPRGPSGGYGGPPNYSQSGQYGGSGAG 454 Query: 486 RGSNPVGG 463 RGSN + G Sbjct: 455 RGSNQMSG 462 >ref|XP_006355337.1| PREDICTED: cyclin-dependent kinase C-1-like [Solanum tuberosum] Length = 512 Score = 96.3 bits (238), Expect = 3e-19 Identities = 45/68 (66%), Positives = 52/68 (76%), Gaps = 1/68 (1%) Frame = -3 Query: 663 QDRGGQSGGYNSGPYPSQGRVPPSYPGNNAPSNGPRGNAGGYGAPPNFSQSGQYGVSG-G 487 QDRG Q GGY+SG YP QGR PP +PG+ +GPRG +GGYG PPN+SQSGQYG SG G Sbjct: 436 QDRGAQGGGYSSGAYPPQGRAPP-FPGSGLAPSGPRGPSGGYGGPPNYSQSGQYGGSGAG 494 Query: 486 RGSNPVGG 463 RGSN + G Sbjct: 495 RGSNQMSG 502 >ref|NP_001234799.1| cyclin dependent kinase C [Solanum lycopersicum] ref|XP_015071462.1| PREDICTED: cyclin-dependent kinase C-1-like isoform X2 [Solanum pennellii] emb|CAC51391.1| cyclin dependent kinase C [Solanum lycopersicum] Length = 512 Score = 96.3 bits (238), Expect = 3e-19 Identities = 45/68 (66%), Positives = 52/68 (76%), Gaps = 1/68 (1%) Frame = -3 Query: 663 QDRGGQSGGYNSGPYPSQGRVPPSYPGNNAPSNGPRGNAGGYGAPPNFSQSGQYGVSG-G 487 QDRG Q GGY+SG YP QGR PP +PG+ +GPRG +GGYG PPN+SQSGQYG SG G Sbjct: 436 QDRGAQGGGYSSGAYPPQGRAPP-FPGSGLAPSGPRGPSGGYGGPPNYSQSGQYGGSGAG 494 Query: 486 RGSNPVGG 463 RGSN + G Sbjct: 495 RGSNQMSG 502 >ref|XP_015071461.1| PREDICTED: cyclin-dependent kinase C-1-like isoform X1 [Solanum pennellii] Length = 543 Score = 96.3 bits (238), Expect = 3e-19 Identities = 45/68 (66%), Positives = 52/68 (76%), Gaps = 1/68 (1%) Frame = -3 Query: 663 QDRGGQSGGYNSGPYPSQGRVPPSYPGNNAPSNGPRGNAGGYGAPPNFSQSGQYGVSG-G 487 QDRG Q GGY+SG YP QGR PP +PG+ +GPRG +GGYG PPN+SQSGQYG SG G Sbjct: 467 QDRGAQGGGYSSGAYPPQGRAPP-FPGSGLAPSGPRGPSGGYGGPPNYSQSGQYGGSGAG 525 Query: 486 RGSNPVGG 463 RGSN + G Sbjct: 526 RGSNQMSG 533 >ref|XP_010319695.1| PREDICTED: cyclin dependent kinase C isoform X1 [Solanum lycopersicum] Length = 543 Score = 96.3 bits (238), Expect = 3e-19 Identities = 45/68 (66%), Positives = 52/68 (76%), Gaps = 1/68 (1%) Frame = -3 Query: 663 QDRGGQSGGYNSGPYPSQGRVPPSYPGNNAPSNGPRGNAGGYGAPPNFSQSGQYGVSG-G 487 QDRG Q GGY+SG YP QGR PP +PG+ +GPRG +GGYG PPN+SQSGQYG SG G Sbjct: 467 QDRGAQGGGYSSGAYPPQGRAPP-FPGSGLAPSGPRGPSGGYGGPPNYSQSGQYGGSGAG 525 Query: 486 RGSNPVGG 463 RGSN + G Sbjct: 526 RGSNQMSG 533 >ref|XP_022870820.1| cyclin-dependent kinase C-1-like [Olea europaea var. sylvestris] Length = 204 Score = 90.1 bits (222), Expect = 2e-18 Identities = 48/66 (72%), Positives = 51/66 (77%) Frame = -3 Query: 663 QDRGGQSGGYNSGPYPSQGRVPPSYPGNNAPSNGPRGNAGGYGAPPNFSQSGQYGVSGGR 484 QDRGGQ+GGYNSG YP QGR P YPG SNGPRG AGGYGA PN+ SGQYG +GGR Sbjct: 133 QDRGGQTGGYNSGQYPPQGRGAP-YPG---ASNGPRGAAGGYGA-PNYPPSGQYG-AGGR 186 Query: 483 GSNPVG 466 G NPVG Sbjct: 187 GPNPVG 192 >dbj|GAV84781.1| Pkinase domain-containing protein [Cephalotus follicularis] Length = 514 Score = 87.8 bits (216), Expect = 3e-16 Identities = 46/69 (66%), Positives = 52/69 (75%), Gaps = 2/69 (2%) Frame = -3 Query: 663 QDRGGQSGGYNSGPYPSQGRVPPSYPGNNAPSNGPRGNAGGYGA-PPNFSQSGQYGVS-G 490 Q+RG Q GGYNSGPYP QGR PP Y G+ P+ GPRG + GY A P N+SQSGQYG S G Sbjct: 438 QNRGSQVGGYNSGPYPPQGRGPP-YAGSGMPA-GPRGPSSGYAAGPTNYSQSGQYGGSAG 495 Query: 489 GRGSNPVGG 463 GRG NP+GG Sbjct: 496 GRGQNPMGG 504 >ref|XP_023901394.1| cyclin-dependent kinase C-1-like [Quercus suber] gb|POE49655.1| cyclin-dependent kinase c-1 [Quercus suber] Length = 516 Score = 85.9 bits (211), Expect = 1e-15 Identities = 43/69 (62%), Positives = 50/69 (72%), Gaps = 2/69 (2%) Frame = -3 Query: 663 QDRGGQSGGYNSGPYPSQGRVPPSYPGNNAPSNGPRGNAGGYG-APPNFSQSGQYGVS-G 490 Q+RG Q GGY+ GPYP QGR PP Y G+ P+ G RG A GYG PPN+SQS Q+G S G Sbjct: 438 QNRGAQVGGYSGGPYPPQGRGPP-YAGSGMPAPGQRGAASGYGVGPPNYSQSSQFGGSAG 496 Query: 489 GRGSNPVGG 463 GRG NP+GG Sbjct: 497 GRGPNPMGG 505